BLASTX nr result
ID: Catharanthus22_contig00040182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00040182 (258 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ14051.1| hypothetical protein PRUPE_ppa021445mg [Prunus pe... 55 9e-06 >gb|EMJ14051.1| hypothetical protein PRUPE_ppa021445mg [Prunus persica] Length = 535 Score = 55.1 bits (131), Expect = 9e-06 Identities = 21/44 (47%), Positives = 32/44 (72%) Frame = +3 Query: 12 SFMWRSIMEGHKLLKQSLYWRIGNGRKVKVRKETWLMTPYEFKL 143 S+ W+ I++GHK+L+ L WRIGNG V ++++ WL PY FK+ Sbjct: 459 SWGWKGIIQGHKVLEAGLRWRIGNGEPVHIKEDGWLPKPYTFKV 502