BLASTX nr result
ID: Catharanthus22_contig00039984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00039984 (527 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004233667.1| PREDICTED: zinc finger protein 252-like [Sol... 59 5e-07 >ref|XP_004233667.1| PREDICTED: zinc finger protein 252-like [Solanum lycopersicum] Length = 460 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 363 EVVQENKFVCKFCNKRCFSGKSLGGHMRGHLALI 464 E Q +KF+CKFC+K C SGKSLGGHMRGHLALI Sbjct: 2 EEPQGHKFICKFCDKSCDSGKSLGGHMRGHLALI 35