BLASTX nr result
ID: Catharanthus22_contig00039525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00039525 (398 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612306.1| HAT family dimerization domain containing pr... 62 8e-08 ref|XP_003621634.1| Serine carboxypeptidase-like protein [Medica... 62 8e-08 ref|XP_003612304.1| F-box protein [Medicago truncatula] gi|35551... 62 1e-07 ref|XP_003631036.1| hypothetical protein MTR_8g106450 [Medicago ... 60 4e-07 ref|XP_003608397.1| Tubulin beta chain [Medicago truncatula] gi|... 57 2e-06 emb|CBI34356.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_002528871.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_003612306.1| HAT family dimerization domain containing protein [Medicago truncatula] gi|355513641|gb|AES95264.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 257 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 382 SHLCAWGNDAASEVLTEARLLLVENYFQTAS 290 +HLCAWGNDAA+EVLTEARLLLVENYFQT S Sbjct: 222 NHLCAWGNDAANEVLTEARLLLVENYFQTPS 252 >ref|XP_003621634.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355496649|gb|AES77852.1| Serine carboxypeptidase-like protein [Medicago truncatula] Length = 105 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 382 SHLCAWGNDAASEVLTEARLLLVENYFQTAS 290 +HLCAWGNDAA+EVLTEARLLLVENYFQT S Sbjct: 75 NHLCAWGNDAANEVLTEARLLLVENYFQTPS 105 >ref|XP_003612304.1| F-box protein [Medicago truncatula] gi|355513639|gb|AES95262.1| F-box protein [Medicago truncatula] Length = 254 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 382 SHLCAWGNDAASEVLTEARLLLVENYFQTAS 290 +HLCAWGNDAA+EVLTEARLLLVENYFQT S Sbjct: 224 NHLCAWGNDAANEVLTEARLLLVENYFQTHS 254 >ref|XP_003631036.1| hypothetical protein MTR_8g106450 [Medicago truncatula] gi|355525058|gb|AET05512.1| hypothetical protein MTR_8g106450 [Medicago truncatula] Length = 220 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -2 Query: 379 HLCAWGNDAASEVLTEARLLLVENYFQTASLAWACLG 269 HLCAWGND A+EV+TEARLLLVENYFQT S LG Sbjct: 183 HLCAWGNDVANEVITEARLLLVENYFQTPSGPELALG 219 >ref|XP_003608397.1| Tubulin beta chain [Medicago truncatula] gi|355509452|gb|AES90594.1| Tubulin beta chain [Medicago truncatula] Length = 65 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 379 HLCAWGNDAASEVLTEARLLLVENYFQTAS 290 HLCAWGNDAA+EV TE RLLLVENYFQT S Sbjct: 36 HLCAWGNDAANEVPTEVRLLLVENYFQTPS 65 >emb|CBI34356.3| unnamed protein product [Vitis vinifera] Length = 28 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 265 MAQGKPRPKRRFGNSFQPAIDAPRLEPH 348 MA KPRPKR FGNSFQPAIDAPRLEPH Sbjct: 1 MAWAKPRPKRGFGNSFQPAIDAPRLEPH 28 >ref|XP_002528871.1| conserved hypothetical protein [Ricinus communis] gi|223531670|gb|EEF33495.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +1 Query: 256 KLMMAQGKPRPKRRFGNSFQPAIDAPRLEPH 348 K A+GKP PKR FGNSFQPAIDAPRLEPH Sbjct: 64 KFSKAKGKPGPKRGFGNSFQPAIDAPRLEPH 94