BLASTX nr result
ID: Catharanthus22_contig00039481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00039481 (261 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT40486.1| putative polyprotein [Solanum demissum] 40 6e-07 emb|CAN67762.1| hypothetical protein VITISV_040650 [Vitis vinifera] 40 1e-05 >gb|AAT40486.1| putative polyprotein [Solanum demissum] Length = 1065 Score = 40.0 bits (92), Expect(2) = 6e-07 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -1 Query: 261 PVFHERTKHIRIDCQFVCDVVQA 193 PVFHERTKHI +DC FV D + A Sbjct: 1000 PVFHERTKHIEVDCHFVRDEIAA 1022 Score = 38.9 bits (89), Expect(2) = 6e-07 Identities = 21/38 (55%), Positives = 23/38 (60%) Frame = -2 Query: 176 SHFQSELQPADILIKAL*PALFQFLTRKLSICDLHALT 63 SH + Q ADI KAL F +L RKL ICDLHA T Sbjct: 1028 SHVHTSQQLADIFTKALGKQQFLYLLRKLVICDLHAPT 1065 >emb|CAN67762.1| hypothetical protein VITISV_040650 [Vitis vinifera] Length = 1316 Score = 40.4 bits (93), Expect(2) = 1e-05 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -1 Query: 261 PVFHERTKHIRIDCQFVCDVVQA 193 PVFHERTKHI IDC FV + VQ+ Sbjct: 1251 PVFHERTKHIEIDCHFVREKVQS 1273 Score = 34.3 bits (77), Expect(2) = 1e-05 Identities = 19/38 (50%), Positives = 24/38 (63%) Frame = -2 Query: 176 SHFQSELQPADILIKAL*PALFQFLTRKLSICDLHALT 63 ++ S+LQ AD+ KAL F FL+ KL I DLHA T Sbjct: 1279 TYLPSKLQXADMFTKALGRQQFLFLSSKLGIRDLHAPT 1316