BLASTX nr result
ID: Catharanthus22_contig00039442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00039442 (320 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006301065.1| hypothetical protein CARUB_v10021458mg [Caps... 51 8e-07 ref|NP_683473.1| uncharacterized protein [Arabidopsis thaliana] ... 57 2e-06 >ref|XP_006301065.1| hypothetical protein CARUB_v10021458mg [Capsella rubella] gi|482569775|gb|EOA33963.1| hypothetical protein CARUB_v10021458mg [Capsella rubella] Length = 302 Score = 50.8 bits (120), Expect(2) = 8e-07 Identities = 23/65 (35%), Positives = 37/65 (56%) Frame = -3 Query: 207 ELHKYFTKDSIIGRNQSVESFWKRIAEDYHKKLQDGWEPRSLRSLQSWWQTVEKVM*KLH 28 E++ ++D I G QS + FW R+ + + W RS +SLQ +Q +E+ KLH Sbjct: 38 EVYLKISQDPITGHYQSSDHFWDRVVKAFEDGKNRTWSKRSKKSLQCRFQNIERATKKLH 97 Query: 27 ACMKQ 13 AC++Q Sbjct: 98 ACIRQ 102 Score = 27.7 bits (60), Expect(2) = 8e-07 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -1 Query: 260 TSSRKLGYNIFEDVQLCESYINISQ 186 + SR GY+ ED LCE Y+ ISQ Sbjct: 21 SGSRSSGYSKEEDKFLCEVYLKISQ 45 >ref|NP_683473.1| uncharacterized protein [Arabidopsis thaliana] gi|332196359|gb|AEE34480.1| uncharacterized protein AT1G66235 [Arabidopsis thaliana] Length = 265 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/58 (46%), Positives = 36/58 (62%) Frame = -3 Query: 189 TKDSIIGRNQSVESFWKRIAEDYHKKLQDGWEPRSLRSLQSWWQTVEKVM*KLHACMK 16 ++D IIG QS + FW R+AE + + W RS +SLQ QT+EK KLHAC+K Sbjct: 4 SQDPIIGVYQSSDHFWDRVAESFENRKNPTWSKRSKKSLQCRLQTIEKASKKLHACIK 61