BLASTX nr result
ID: Catharanthus22_contig00039367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00039367 (230 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY11293.1| Sodium/hydrogen exchanger 1 [Theobroma cacao] 78 1e-12 ref|XP_006375776.1| hypothetical protein POPTR_0013s02760g [Popu... 77 2e-12 ref|XP_002512334.1| sodium/hydrogen exchanger, putative [Ricinus... 76 5e-12 gb|ACU01856.1| Na+/H+ exchanger 5 [Populus euphratica] 75 1e-11 ref|XP_006850842.1| hypothetical protein AMTR_s00025p00134170 [A... 71 2e-10 ref|XP_004495748.1| PREDICTED: sodium/hydrogen exchanger 1-like ... 70 2e-10 gb|AGE34250.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|... 70 3e-10 gb|AGE34232.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|... 70 3e-10 gb|AGE33020.1| Na+/H+ antiporter, partial [Populus euphratica] g... 70 3e-10 gb|AGE33019.1| Na+/H+ antiporter, partial [Populus euphratica] g... 70 3e-10 gb|AGE33012.1| Na+/H+ antiporter, partial [Populus euphratica] g... 70 3e-10 gb|ADL27439.1| Na+/H+ antiporter protein [Fagopyrum tataricum] 70 3e-10 gb|ACU01853.1| Na+/H+ exchanger 2 [Populus euphratica] 70 3e-10 ref|XP_002516862.1| sodium/hydrogen exchanger, putative [Ricinus... 70 3e-10 dbj|BAE95195.1| putative Na+/H+ antiporter [Suaeda japonica] 70 4e-10 gb|AAP15178.1| Na+/H+ antiporter [Suaeda salsa] 70 4e-10 gb|AAK53432.1| Na+/H+ antiporter [Suaeda salsa] 70 4e-10 dbj|BAB11940.1| Na/H antiporter Nhx1 [Atriplex gmelini] gi|54869... 69 5e-10 ref|XP_006299163.1| hypothetical protein CARUB_v10015306mg [Caps... 69 5e-10 gb|AAO48271.1| Na/H antiporter Nhx1 [Atriplex dimorphostegia] 69 5e-10 >gb|EOY11293.1| Sodium/hydrogen exchanger 1 [Theobroma cacao] Length = 547 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = +1 Query: 1 RNSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSSTSIAHE 150 R+SL LM H T+TVH+ WR+FDDRFMRP+FGGRGF PFVP S T A E Sbjct: 493 RSSLRLLMTHPTWTVHYLWRKFDDRFMRPVFGGRGFVPFVPGSPTGAADE 542 >ref|XP_006375776.1| hypothetical protein POPTR_0013s02760g [Populus trichocarpa] gi|550324793|gb|ERP53573.1| hypothetical protein POPTR_0013s02760g [Populus trichocarpa] Length = 538 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = +1 Query: 4 NSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSSTSIAHE 150 +SL L+RH T TVH+FWR+FDDRFMRP+FGGRGF PFVPS+ T A E Sbjct: 486 SSLRLLIRHPTTTVHYFWRKFDDRFMRPMFGGRGFVPFVPSTPTGAADE 534 >ref|XP_002512334.1| sodium/hydrogen exchanger, putative [Ricinus communis] gi|223548295|gb|EEF49786.1| sodium/hydrogen exchanger, putative [Ricinus communis] Length = 709 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +1 Query: 4 NSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSSTSIAHE 150 +SL L+ H T TVH+ WRRFDDRFMRP+FGGRGF PF+PSS T A E Sbjct: 657 SSLRLLITHPTVTVHYLWRRFDDRFMRPVFGGRGFVPFIPSSPTGAADE 705 >gb|ACU01856.1| Na+/H+ exchanger 5 [Populus euphratica] Length = 555 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +1 Query: 7 SLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSSTSIAHE 150 SL L+ H T TVH+FWR+FDDRFMRP+FGGRGF PFVPS+ T A E Sbjct: 504 SLRLLISHPTTTVHYFWRKFDDRFMRPMFGGRGFVPFVPSTPTGAADE 551 >ref|XP_006850842.1| hypothetical protein AMTR_s00025p00134170 [Amborella trichopoda] gi|548854513|gb|ERN12423.1| hypothetical protein AMTR_s00025p00134170 [Amborella trichopoda] Length = 508 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = +1 Query: 1 RNSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSSTSIAHE 150 RNS L++ T T+H+FWR+FDD +MRP+FGGRGF PFVPSS T E Sbjct: 457 RNSFRLLLKAPTSTIHYFWRKFDDSYMRPVFGGRGFVPFVPSSPTGANDE 506 >ref|XP_004495748.1| PREDICTED: sodium/hydrogen exchanger 1-like [Cicer arietinum] Length = 561 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +1 Query: 1 RNSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSS 129 R+SL ++RH T TVH+FWR+FDD+FMRP+FGGRGF P VP S Sbjct: 511 RSSLSLMIRHPTTTVHYFWRKFDDKFMRPVFGGRGFIPAVPGS 553 >gb|AGE34250.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392089|gb|AGE34252.1| Na+/H+ antiporter, partial [Populus pruinosa] Length = 198 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +1 Query: 1 RNSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 R+S+ +L+ T TVHH+WR+FDD FMRP+FGGRGF PFVP S T Sbjct: 154 RSSIRALLTTPTHTVHHYWRKFDDAFMRPMFGGRGFVPFVPGSPT 198 >gb|AGE34232.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392051|gb|AGE34233.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392061|gb|AGE34238.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392063|gb|AGE34239.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392071|gb|AGE34243.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392079|gb|AGE34247.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392113|gb|AGE34264.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392115|gb|AGE34265.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392117|gb|AGE34266.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392119|gb|AGE34267.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392121|gb|AGE34268.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392123|gb|AGE34269.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392125|gb|AGE34270.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392127|gb|AGE34271.1| Na+/H+ antiporter, partial [Populus pruinosa] Length = 198 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +1 Query: 1 RNSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 R+S+ +L+ T TVHH+WR+FDD FMRP+FGGRGF PFVP S T Sbjct: 154 RSSIRALLTTPTHTVHHYWRKFDDAFMRPMFGGRGFVPFVPGSPT 198 >gb|AGE33020.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388516|gb|AGE33033.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388538|gb|AGE33044.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388540|gb|AGE33045.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388562|gb|AGE33056.1| Na+/H+ antiporter, partial [Populus euphratica] Length = 198 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +1 Query: 1 RNSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 R+S+ +L+ T TVHH+WR+FDD FMRP+FGGRGF PFVP S T Sbjct: 154 RSSIRALLTTPTHTVHHYWRKFDDAFMRPMFGGRGFVPFVPGSPT 198 >gb|AGE33019.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388510|gb|AGE33030.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388512|gb|AGE33031.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388534|gb|AGE33042.1| Na+/H+ antiporter, partial [Populus euphratica] Length = 198 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +1 Query: 1 RNSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 R+S+ +L+ T TVHH+WR+FDD FMRP+FGGRGF PFVP S T Sbjct: 154 RSSIRALLTTPTHTVHHYWRKFDDAFMRPMFGGRGFVPFVPGSPT 198 >gb|AGE33012.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388476|gb|AGE33013.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388478|gb|AGE33014.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388480|gb|AGE33015.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388482|gb|AGE33016.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388484|gb|AGE33017.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388486|gb|AGE33018.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388492|gb|AGE33021.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388494|gb|AGE33022.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388496|gb|AGE33023.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388498|gb|AGE33024.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388500|gb|AGE33025.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388502|gb|AGE33026.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388504|gb|AGE33027.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388506|gb|AGE33028.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388508|gb|AGE33029.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388514|gb|AGE33032.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388518|gb|AGE33034.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388520|gb|AGE33035.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388522|gb|AGE33036.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388524|gb|AGE33037.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388526|gb|AGE33038.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388528|gb|AGE33039.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388530|gb|AGE33040.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388532|gb|AGE33041.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388536|gb|AGE33043.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388542|gb|AGE33046.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388544|gb|AGE33047.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388546|gb|AGE33048.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388548|gb|AGE33049.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388550|gb|AGE33050.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388552|gb|AGE33051.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388554|gb|AGE33052.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388556|gb|AGE33053.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388558|gb|AGE33054.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388560|gb|AGE33055.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388564|gb|AGE33057.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388566|gb|AGE33058.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447388568|gb|AGE33059.1| Na+/H+ antiporter, partial [Populus euphratica] gi|447392033|gb|AGE34224.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392035|gb|AGE34225.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392037|gb|AGE34226.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392039|gb|AGE34227.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392041|gb|AGE34228.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392043|gb|AGE34229.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392045|gb|AGE34230.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392047|gb|AGE34231.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392053|gb|AGE34234.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392055|gb|AGE34235.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392057|gb|AGE34236.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392059|gb|AGE34237.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392065|gb|AGE34240.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392067|gb|AGE34241.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392069|gb|AGE34242.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392073|gb|AGE34244.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392075|gb|AGE34245.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392077|gb|AGE34246.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392081|gb|AGE34248.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392083|gb|AGE34249.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392087|gb|AGE34251.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392091|gb|AGE34253.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392093|gb|AGE34254.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392095|gb|AGE34255.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392097|gb|AGE34256.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392099|gb|AGE34257.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392101|gb|AGE34258.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392103|gb|AGE34259.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392105|gb|AGE34260.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392107|gb|AGE34261.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392109|gb|AGE34262.1| Na+/H+ antiporter, partial [Populus pruinosa] gi|447392111|gb|AGE34263.1| Na+/H+ antiporter, partial [Populus pruinosa] Length = 198 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +1 Query: 1 RNSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 R+S+ +L+ T TVHH+WR+FDD FMRP+FGGRGF PFVP S T Sbjct: 154 RSSIRALLTTPTHTVHHYWRKFDDAFMRPMFGGRGFVPFVPGSPT 198 >gb|ADL27439.1| Na+/H+ antiporter protein [Fagopyrum tataricum] Length = 553 Score = 70.1 bits (170), Expect = 3e-10 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +1 Query: 19 LMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 L+RH T+TVHH WR+FDD+FMRP+FGGRGF P+ P S T Sbjct: 500 LIRHPTWTVHHLWRKFDDKFMRPVFGGRGFVPYQPGSPT 538 >gb|ACU01853.1| Na+/H+ exchanger 2 [Populus euphratica] Length = 544 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +1 Query: 1 RNSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 R+S+ +L+ T TVHH+WR+FDD FMRP+FGGRGF PFVP S T Sbjct: 491 RSSIRALLTTPTHTVHHYWRKFDDAFMRPMFGGRGFVPFVPGSPT 535 >ref|XP_002516862.1| sodium/hydrogen exchanger, putative [Ricinus communis] gi|223543950|gb|EEF45476.1| sodium/hydrogen exchanger, putative [Ricinus communis] Length = 541 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +1 Query: 4 NSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 +SL+ L+ ++TVHH+WR+FDD FMRP+FGGRGF PFVP S T Sbjct: 489 SSLMMLLSTPSYTVHHYWRKFDDAFMRPVFGGRGFVPFVPCSPT 532 >dbj|BAE95195.1| putative Na+/H+ antiporter [Suaeda japonica] Length = 554 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = +1 Query: 7 SLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 SL L+ T TVHH+WRRFDD FMRP+FGGRGF PFVP S T Sbjct: 501 SLRMLLNAPTHTVHHYWRRFDDYFMRPVFGGRGFVPFVPGSPT 543 >gb|AAP15178.1| Na+/H+ antiporter [Suaeda salsa] Length = 557 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = +1 Query: 7 SLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 SL L+ T TVHH+WRRFDD FMRP+FGGRGF PFVP S T Sbjct: 504 SLRMLLNAPTHTVHHYWRRFDDYFMRPVFGGRGFVPFVPGSPT 546 >gb|AAK53432.1| Na+/H+ antiporter [Suaeda salsa] Length = 556 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = +1 Query: 7 SLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 SL L+ T TVHH+WRRFDD FMRP+FGGRGF PFVP S T Sbjct: 501 SLRMLLNAPTHTVHHYWRRFDDYFMRPVFGGRGFVPFVPGSPT 543 >dbj|BAB11940.1| Na/H antiporter Nhx1 [Atriplex gmelini] gi|548691666|gb|AGX13726.1| Na+/H+ antiporter [synthetic construct] Length = 555 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 4 NSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 +SL L+ T TVHH+WR+FDD FMRP+FGGRGF PFVP S T Sbjct: 501 SSLRMLLNAPTHTVHHYWRKFDDSFMRPVFGGRGFVPFVPGSPT 544 >ref|XP_006299163.1| hypothetical protein CARUB_v10015306mg [Capsella rubella] gi|482567872|gb|EOA32061.1| hypothetical protein CARUB_v10015306mg [Capsella rubella] Length = 539 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 4 NSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 NSL + T TVHH+WR+FDD FMRP+FGGRGF PFVP S T Sbjct: 486 NSLRGFLMRPTRTVHHYWRQFDDAFMRPVFGGRGFVPFVPGSPT 529 >gb|AAO48271.1| Na/H antiporter Nhx1 [Atriplex dimorphostegia] Length = 555 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 4 NSLISLMRHSTFTVHHFWRRFDDRFMRPIFGGRGFAPFVPSSST 135 +SL L+ T TVHH+WR+FDD FMRP+FGGRGF PFVP S T Sbjct: 501 SSLRMLLNAPTHTVHHYWRKFDDSFMRPVFGGRGFVPFVPGSPT 544