BLASTX nr result
ID: Catharanthus22_contig00039132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00039132 (350 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY01700.1| Uncharacterized protein isoform 3 [Theobroma cacao] 86 5e-15 gb|EOY01699.1| Uncharacterized protein isoform 2, partial [Theob... 86 5e-15 gb|EOY01698.1| Uncharacterized protein isoform 1 [Theobroma cacao] 86 5e-15 ref|XP_002312282.2| hypothetical protein POPTR_0008s09520g [Popu... 83 3e-14 ref|XP_006484204.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 82 6e-14 ref|XP_006437933.1| hypothetical protein CICLE_v10031554mg [Citr... 82 6e-14 ref|XP_006437932.1| hypothetical protein CICLE_v10031554mg [Citr... 82 6e-14 ref|XP_006437930.1| hypothetical protein CICLE_v10031554mg [Citr... 82 6e-14 ref|XP_006437929.1| hypothetical protein CICLE_v10031554mg [Citr... 82 6e-14 ref|XP_006437927.1| hypothetical protein CICLE_v10031554mg [Citr... 82 6e-14 ref|XP_006307559.1| hypothetical protein CARUB_v10009181mg [Caps... 81 1e-13 ref|XP_002274189.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 81 1e-13 ref|XP_006417091.1| hypothetical protein EUTSA_v10007655mg [Eutr... 81 2e-13 ref|XP_002890020.1| hypothetical protein ARALYDRAFT_888749 [Arab... 80 3e-13 gb|ESW25516.1| hypothetical protein PHAVU_003G042500g [Phaseolus... 80 4e-13 ref|XP_004297238.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 80 4e-13 ref|XP_003614098.1| hypothetical protein MTR_5g044720 [Medicago ... 79 5e-13 ref|XP_006830666.1| hypothetical protein AMTR_s00210p00025080 [A... 79 6e-13 ref|NP_172832.3| uncharacterized protein [Arabidopsis thaliana] ... 79 6e-13 ref|XP_006348690.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 79 8e-13 >gb|EOY01700.1| Uncharacterized protein isoform 3 [Theobroma cacao] Length = 302 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 FNH+ RR L+AFVPEGFPGSVTPDYVPFQ+WDSLQGLSTYIR Sbjct: 44 FNHVWRRFLDAFVPEGFPGSVTPDYVPFQVWDSLQGLSTYIR 85 >gb|EOY01699.1| Uncharacterized protein isoform 2, partial [Theobroma cacao] Length = 338 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 FNH+ RR L+AFVPEGFPGSVTPDYVPFQ+WDSLQGLSTYIR Sbjct: 44 FNHVWRRFLDAFVPEGFPGSVTPDYVPFQVWDSLQGLSTYIR 85 >gb|EOY01698.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 437 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 FNH+ RR L+AFVPEGFPGSVTPDYVPFQ+WDSLQGLSTYIR Sbjct: 44 FNHVWRRFLDAFVPEGFPGSVTPDYVPFQVWDSLQGLSTYIR 85 >ref|XP_002312282.2| hypothetical protein POPTR_0008s09520g [Populus trichocarpa] gi|550332731|gb|EEE89649.2| hypothetical protein POPTR_0008s09520g [Populus trichocarpa] Length = 446 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 FNH+ RR+L+AFVPEGFP SVTPDY PFQ+WDSLQGLSTYIR Sbjct: 53 FNHVWRRVLQAFVPEGFPSSVTPDYAPFQVWDSLQGLSTYIR 94 >ref|XP_006484204.1| PREDICTED: UPF0420 protein C16orf58 homolog [Citrus sinensis] Length = 440 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 F H+ R+L+AFVPEGFPGSVTPDYVPFQ+WDSLQGLSTYIR Sbjct: 48 FTHVWSRVLQAFVPEGFPGSVTPDYVPFQVWDSLQGLSTYIR 89 >ref|XP_006437933.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] gi|557540129|gb|ESR51173.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] Length = 332 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 F H+ R+L+AFVPEGFPGSVTPDYVPFQ+WDSLQGLSTYIR Sbjct: 48 FTHVWSRVLQAFVPEGFPGSVTPDYVPFQVWDSLQGLSTYIR 89 >ref|XP_006437932.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] gi|557540128|gb|ESR51172.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] Length = 440 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 F H+ R+L+AFVPEGFPGSVTPDYVPFQ+WDSLQGLSTYIR Sbjct: 48 FTHVWSRVLQAFVPEGFPGSVTPDYVPFQVWDSLQGLSTYIR 89 >ref|XP_006437930.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] gi|557540126|gb|ESR51170.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] Length = 305 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 F H+ R+L+AFVPEGFPGSVTPDYVPFQ+WDSLQGLSTYIR Sbjct: 48 FTHVWSRVLQAFVPEGFPGSVTPDYVPFQVWDSLQGLSTYIR 89 >ref|XP_006437929.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] gi|557540125|gb|ESR51169.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] Length = 289 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 F H+ R+L+AFVPEGFPGSVTPDYVPFQ+WDSLQGLSTYIR Sbjct: 48 FTHVWSRVLQAFVPEGFPGSVTPDYVPFQVWDSLQGLSTYIR 89 >ref|XP_006437927.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] gi|567890815|ref|XP_006437928.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] gi|567890827|ref|XP_006437934.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] gi|557540123|gb|ESR51167.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] gi|557540124|gb|ESR51168.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] gi|557540130|gb|ESR51174.1| hypothetical protein CICLE_v10031554mg [Citrus clementina] Length = 260 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 F H+ R+L+AFVPEGFPGSVTPDYVPFQ+WDSLQGLSTYIR Sbjct: 48 FTHVWSRVLQAFVPEGFPGSVTPDYVPFQVWDSLQGLSTYIR 89 >ref|XP_006307559.1| hypothetical protein CARUB_v10009181mg [Capsella rubella] gi|482576270|gb|EOA40457.1| hypothetical protein CARUB_v10009181mg [Capsella rubella] Length = 436 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 FNHI RR+L+AFVPEGFPGSVTPDYV FQ+WD+LQGLSTYI+ Sbjct: 47 FNHIWRRVLQAFVPEGFPGSVTPDYVGFQLWDTLQGLSTYIK 88 >ref|XP_002274189.1| PREDICTED: UPF0420 protein C16orf58 homolog [Vitis vinifera] gi|297738087|emb|CBI27288.3| unnamed protein product [Vitis vinifera] Length = 437 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 F+H+ RRIL+AFVPEGFP SVTPDY PFQ+WDSLQGLSTYIR Sbjct: 44 FSHVWRRILQAFVPEGFPSSVTPDYAPFQLWDSLQGLSTYIR 85 >ref|XP_006417091.1| hypothetical protein EUTSA_v10007655mg [Eutrema salsugineum] gi|557094862|gb|ESQ35444.1| hypothetical protein EUTSA_v10007655mg [Eutrema salsugineum] Length = 440 Score = 80.9 bits (198), Expect = 2e-13 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 FNH+ RR+L+AFVPEGFPGSVTPDYV FQ+WD+LQGLSTYI+ Sbjct: 46 FNHVWRRVLQAFVPEGFPGSVTPDYVGFQLWDTLQGLSTYIK 87 >ref|XP_002890020.1| hypothetical protein ARALYDRAFT_888749 [Arabidopsis lyrata subsp. lyrata] gi|297335862|gb|EFH66279.1| hypothetical protein ARALYDRAFT_888749 [Arabidopsis lyrata subsp. lyrata] Length = 440 Score = 80.1 bits (196), Expect = 3e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 FNH+ RR+L+AFVPEGFPGSVTPDYV FQ WD+LQGLSTYI+ Sbjct: 46 FNHVWRRVLQAFVPEGFPGSVTPDYVGFQFWDTLQGLSTYIK 87 >gb|ESW25516.1| hypothetical protein PHAVU_003G042500g [Phaseolus vulgaris] Length = 475 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 F+H+ RR+L+AFVPEGFP SVT DYVPFQIWDSLQGLSTYIR Sbjct: 83 FSHVWRRLLQAFVPEGFPSSVTADYVPFQIWDSLQGLSTYIR 124 >ref|XP_004297238.1| PREDICTED: UPF0420 protein C16orf58 homolog [Fragaria vesca subsp. vesca] Length = 437 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 F+H+ +R+L+AFVPEGFP SVTPDYVPFQ+WDSLQGLSTYIR Sbjct: 44 FDHVWQRMLQAFVPEGFPSSVTPDYVPFQMWDSLQGLSTYIR 85 >ref|XP_003614098.1| hypothetical protein MTR_5g044720 [Medicago truncatula] gi|355515433|gb|AES97056.1| hypothetical protein MTR_5g044720 [Medicago truncatula] Length = 749 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 F H+ RR L+AFVPEGFP SVTPDYVPFQIWD LQGLSTYIR Sbjct: 356 FTHVWRRFLQAFVPEGFPSSVTPDYVPFQIWDLLQGLSTYIR 397 >ref|XP_006830666.1| hypothetical protein AMTR_s00210p00025080 [Amborella trichopoda] gi|548837256|gb|ERM98082.1| hypothetical protein AMTR_s00210p00025080 [Amborella trichopoda] Length = 433 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 F RR+L AFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR Sbjct: 41 FVEFRRRVLAAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 82 >ref|NP_172832.3| uncharacterized protein [Arabidopsis thaliana] gi|28393739|gb|AAO42280.1| unknown protein [Arabidopsis thaliana] gi|28973405|gb|AAO64027.1| unknown protein [Arabidopsis thaliana] gi|332190945|gb|AEE29066.1| uncharacterized protein AT1G13770 [Arabidopsis thaliana] Length = 440 Score = 79.0 bits (193), Expect = 6e-13 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 FNH+ RR+L+AFVPEGFPGSVTPDYV FQ+WD+LQGLSTY + Sbjct: 46 FNHVWRRVLQAFVPEGFPGSVTPDYVGFQLWDTLQGLSTYTK 87 >ref|XP_006348690.1| PREDICTED: UPF0420 protein C16orf58 homolog [Solanum tuberosum] Length = 450 Score = 78.6 bits (192), Expect = 8e-13 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 224 FNHITRRILEAFVPEGFPGSVTPDYVPFQIWDSLQGLSTYIR 349 F HI++RIL+AFVPEG+P SVTPDY PFQ+WDSLQGLSTY+R Sbjct: 56 FTHISQRILQAFVPEGYPTSVTPDYFPFQVWDSLQGLSTYVR 97