BLASTX nr result
ID: Catharanthus22_contig00039074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00039074 (549 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513947.1| conserved hypothetical protein [Ricinus comm... 55 9e-06 >ref|XP_002513947.1| conserved hypothetical protein [Ricinus communis] gi|223547033|gb|EEF48530.1| conserved hypothetical protein [Ricinus communis] Length = 169 Score = 55.5 bits (132), Expect = 9e-06 Identities = 23/47 (48%), Positives = 37/47 (78%) Frame = +1 Query: 271 IWVALIIQYTVEDATKQKFMVGKFYQS*MIEDRESKVQIYEFQKIFE 411 IW +++ +YT +DA KQKF++GKFY+ M+ED++ K+QI E+ K+ E Sbjct: 114 IWDSMVNKYTAKDAGKQKFVIGKFYKWEMMEDKDIKLQINEYHKLLE 160