BLASTX nr result
ID: Catharanthus22_contig00039064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00039064 (390 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 73 3e-11 ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 64 2e-08 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 73.2 bits (178), Expect = 3e-11 Identities = 45/69 (65%), Positives = 47/69 (68%), Gaps = 2/69 (2%) Frame = -1 Query: 336 MAKSVDATDLIGLSLGMETY*VITFKFRETPELIKGAILSQIQFSTNTNKG--SENEKGI 163 MA+ VDATDLIGLSLGMETY V TFKFRET EL G F NK SEN+K I Sbjct: 1 MAELVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSFRKQINKSLESENKKRI 60 Query: 162 GAETQRKLF 136 GAETQ KLF Sbjct: 61 GAETQWKLF 69 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|357471517|ref|XP_003606043.1| hypothetical protein MTR_4g051230 [Medicago truncatula] gi|358349395|ref|XP_003638723.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355504658|gb|AES85861.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|355507098|gb|AES88240.1| hypothetical protein MTR_4g051230 [Medicago truncatula] Length = 95 Score = 64.3 bits (155), Expect = 2e-08 Identities = 40/66 (60%), Positives = 41/66 (62%), Gaps = 2/66 (3%) Frame = -1 Query: 336 MAKSVDATDLIGLSLGMETY*VITFKFRETPELIKGAILSQIQFSTNTNKG--SENEKGI 163 MAK VDATDLIGLSLGMETY V TFKFRET EL G F NK SEN+K I Sbjct: 1 MAKLVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSFRKQINKSLESENQKRI 60 Query: 162 GAETQR 145 G R Sbjct: 61 GGGVSR 66