BLASTX nr result
ID: Catharanthus22_contig00038515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00038515 (351 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ08026.1| hypothetical protein PRUPE_ppa026294mg, partial [... 65 9e-09 emb|CBI15870.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|XP_004151059.1| PREDICTED: GDSL esterase/lipase At2g30310-li... 62 8e-08 ref|XP_004490678.1| PREDICTED: GDSL esterase/lipase At2g30310-li... 61 1e-07 ref|XP_004168797.1| PREDICTED: GDSL esterase/lipase At2g30310-li... 61 2e-07 ref|XP_004143225.1| PREDICTED: GDSL esterase/lipase At2g30310-li... 61 2e-07 ref|XP_003617616.1| GDSL esterase/lipase [Medicago truncatula] g... 61 2e-07 ref|XP_003599653.1| GDSL esterase/lipase [Medicago truncatula] g... 61 2e-07 emb|CAN59817.1| hypothetical protein VITISV_020321 [Vitis vinifera] 61 2e-07 ref|XP_002312198.1| hypothetical protein POPTR_0008s07630g [Popu... 60 2e-07 ref|XP_006344610.1| PREDICTED: GDSL esterase/lipase At2g31550-li... 60 3e-07 ref|XP_003615938.1| GDSL esterase/lipase [Medicago truncatula] g... 60 3e-07 ref|XP_004296046.1| PREDICTED: GDSL esterase/lipase At2g30310-li... 60 4e-07 ref|XP_003518328.2| PREDICTED: GDSL esterase/lipase At2g30310-li... 59 9e-07 ref|XP_004246974.1| PREDICTED: GDSL esterase/lipase At2g30310-li... 58 1e-06 gb|EPS66683.1| hypothetical protein M569_08095, partial [Genlise... 56 4e-06 gb|EMJ21569.1| hypothetical protein PRUPE_ppa017759mg [Prunus pe... 56 4e-06 >gb|EMJ08026.1| hypothetical protein PRUPE_ppa026294mg, partial [Prunus persica] Length = 354 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = +3 Query: 3 GPLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKILLPILSH 143 GPLCN TP+C N +YLFWDSIHPSEA Y + S L K +LP L++ Sbjct: 290 GPLCNALTPLCANDLEYLFWDSIHPSEAAYQYISKYLEKEVLPKLAY 336 >emb|CBI15870.3| unnamed protein product [Vitis vinifera] Length = 666 Score = 63.2 bits (152), Expect = 3e-08 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +3 Query: 3 GPLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKIL 125 GPLCN TPVC NASQY+FWDSIHP+EA Y + L K L Sbjct: 614 GPLCNSLTPVCENASQYVFWDSIHPTEAAYRVLVEYLEKDL 654 >ref|XP_004151059.1| PREDICTED: GDSL esterase/lipase At2g30310-like [Cucumis sativus] gi|449514951|ref|XP_004164523.1| PREDICTED: GDSL esterase/lipase At2g30310-like [Cucumis sativus] Length = 364 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +3 Query: 3 GPLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKIL 125 GPLCN TP C N+S+++FWDSIHP+EA Y F ++ L+K L Sbjct: 317 GPLCNPKTPTCENSSKFMFWDSIHPTEAAYKFIAEALLKKL 357 >ref|XP_004490678.1| PREDICTED: GDSL esterase/lipase At2g30310-like [Cicer arietinum] Length = 356 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = +3 Query: 6 PLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKILLP 131 PLCNE TPVC +AS+Y+FWDS+HP+EATY + ++ +LP Sbjct: 313 PLCNELTPVCDDASKYVFWDSVHPTEATYQYVANYFEMEVLP 354 >ref|XP_004168797.1| PREDICTED: GDSL esterase/lipase At2g30310-like [Cucumis sativus] Length = 361 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +3 Query: 3 GPLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLV 116 GPLCN+ TP C + S+++FWDSIHPSEATY F ++ L+ Sbjct: 316 GPLCNKITPTCEDPSKFMFWDSIHPSEATYKFVTESLL 353 >ref|XP_004143225.1| PREDICTED: GDSL esterase/lipase At2g30310-like [Cucumis sativus] Length = 361 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +3 Query: 3 GPLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLV 116 GPLCN+ TP C + S+++FWDSIHPSEATY F ++ L+ Sbjct: 316 GPLCNKITPTCEDPSKFMFWDSIHPSEATYKFVTESLL 353 >ref|XP_003617616.1| GDSL esterase/lipase [Medicago truncatula] gi|355518951|gb|AET00575.1| GDSL esterase/lipase [Medicago truncatula] Length = 149 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/50 (52%), Positives = 34/50 (68%) Frame = +3 Query: 6 PLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKILLPILSHTESC 155 PLCNE TPVC +AS+Y+FWDS+HPSEAT + + L +LP +C Sbjct: 97 PLCNELTPVCDDASKYVFWDSVHPSEATNKYIAKYLELEVLPKFQFHRNC 146 >ref|XP_003599653.1| GDSL esterase/lipase [Medicago truncatula] gi|357491297|ref|XP_003615936.1| GDSL esterase/lipase [Medicago truncatula] gi|355488701|gb|AES69904.1| GDSL esterase/lipase [Medicago truncatula] gi|355517271|gb|AES98894.1| GDSL esterase/lipase [Medicago truncatula] Length = 221 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/50 (52%), Positives = 34/50 (68%) Frame = +3 Query: 6 PLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKILLPILSHTESC 155 PLCNE TPVC +AS+Y+FWDS+HPSEAT + + L +LP +C Sbjct: 169 PLCNELTPVCDDASKYVFWDSVHPSEATNKYIAKYLELEVLPKFQFHRNC 218 >emb|CAN59817.1| hypothetical protein VITISV_020321 [Vitis vinifera] Length = 340 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 3 GPLCNEATPVCRNASQYLFWDSIHPSEATY 92 GPLCN TPVC NASQY+FWDSIHP+EA Y Sbjct: 311 GPLCNSLTPVCENASQYVFWDSIHPTEAAY 340 >ref|XP_002312198.1| hypothetical protein POPTR_0008s07630g [Populus trichocarpa] gi|222852018|gb|EEE89565.1| hypothetical protein POPTR_0008s07630g [Populus trichocarpa] Length = 350 Score = 60.5 bits (145), Expect = 2e-07 Identities = 22/43 (51%), Positives = 32/43 (74%) Frame = +3 Query: 3 GPLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKILLP 131 GPLCN TP CR+ S+YLFWD++HP ++TY + + + K +LP Sbjct: 305 GPLCNPTTPTCRHPSRYLFWDAVHPGQSTYQYLTKYVEKKVLP 347 >ref|XP_006344610.1| PREDICTED: GDSL esterase/lipase At2g31550-like [Solanum tuberosum] Length = 357 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = +3 Query: 3 GPLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKIL 125 GP CN+ PVC+NAS+YLFWDSIHP E+ Y S+ +K L Sbjct: 306 GPFCNKHRPVCKNASEYLFWDSIHPGESAYQHLSNMAMKKL 346 >ref|XP_003615938.1| GDSL esterase/lipase [Medicago truncatula] gi|355517273|gb|AES98896.1| GDSL esterase/lipase [Medicago truncatula] Length = 366 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = +3 Query: 6 PLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKILLPILSHTESC 155 PLCNE TPVC +AS+Y+FWDS+HPSEAT + + + +LP +C Sbjct: 313 PLCNELTPVCDDASKYVFWDSVHPSEATNKYIAKYMELEVLPKFQFHRNC 362 >ref|XP_004296046.1| PREDICTED: GDSL esterase/lipase At2g30310-like [Fragaria vesca subsp. vesca] Length = 367 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = +3 Query: 3 GPLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKILLPIL 137 GP CN T VC NA +YLFWD IHPSEA Y + S L K ++P L Sbjct: 316 GPFCNALTAVCDNALEYLFWDGIHPSEAAYEYISKYLEKNVVPQL 360 >ref|XP_003518328.2| PREDICTED: GDSL esterase/lipase At2g30310-like [Glycine max] Length = 364 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = +3 Query: 6 PLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKILLP 131 PLCNE TP+C + S+Y+FWDS+HP+E TY + + L +LP Sbjct: 313 PLCNEFTPICEDPSKYVFWDSVHPTEITYQYIAKYLEMEVLP 354 >ref|XP_004246974.1| PREDICTED: GDSL esterase/lipase At2g30310-like [Solanum lycopersicum] Length = 353 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +3 Query: 3 GPLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKIL 125 GP CN+ PVC+NASQYLFWDSIHP ++ Y S +K L Sbjct: 306 GPFCNKHHPVCKNASQYLFWDSIHPGQSAYQHLSHIAMKKL 346 >gb|EPS66683.1| hypothetical protein M569_08095, partial [Genlisea aurea] Length = 148 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/45 (51%), Positives = 33/45 (73%) Frame = +3 Query: 3 GPLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKILLPIL 137 GPLC E +PVC N QY+F+DS+HP+++ Y + +LV+ LLP L Sbjct: 104 GPLCTELSPVCSNPEQYMFFDSVHPTQSVYALVARRLVERLLPRL 148 >gb|EMJ21569.1| hypothetical protein PRUPE_ppa017759mg [Prunus persica] Length = 361 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = +3 Query: 3 GPLCNEATPVCRNASQYLFWDSIHPSEATYHFFSDQLVKILLPIL 137 GPLC E + C +AS++LFWDS+HPS+A Y +D K +LP L Sbjct: 315 GPLCGELSLTCTDASKFLFWDSMHPSQAAYSVLADMAQKTVLPYL 359