BLASTX nr result
ID: Catharanthus22_contig00038468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00038468 (263 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65979.1| hypothetical protein [Beta vulgaris subsp. vulga... 53 8e-06 >emb|CCA65979.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1110 Score = 53.1 bits (126), Expect(2) = 8e-06 Identities = 25/48 (52%), Positives = 33/48 (68%) Frame = -1 Query: 263 IMNFVQSVSSQVLINSFPTRSFNSERGLRLGDALSSFLFAICVEGLIR 120 IM V +VS VL+N PT+ F + +GLR GD +S FLFA+C+E L R Sbjct: 614 IMECVSTVSYSVLVNGIPTQPFQARKGLRQGDPMSPFLFALCMEYLSR 661 Score = 21.9 bits (45), Expect(2) = 8e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -2 Query: 52 ITHLFFAGDNLLF 14 ITHL FA D L+F Sbjct: 683 ITHLMFADDLLMF 695