BLASTX nr result
ID: Catharanthus22_contig00038093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00038093 (230 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY14466.1| Alpha-amylase-like isoform 2 [Theobroma cacao] 56 4e-06 gb|EOY14465.1| Alpha-amylase-like isoform 1 [Theobroma cacao] 56 4e-06 >gb|EOY14466.1| Alpha-amylase-like isoform 2 [Theobroma cacao] Length = 354 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/43 (69%), Positives = 31/43 (72%) Frame = +1 Query: 97 SLAFLCLFLLIPFSAFAAPPHTLLFQGFNWESSNKAGRWYNEL 225 SL FL LFL I F A +P TLLFQGFNWES NKAG WYN L Sbjct: 6 SLCFLSLFLYI-FPALTSP--TLLFQGFNWESCNKAGGWYNSL 45 >gb|EOY14465.1| Alpha-amylase-like isoform 1 [Theobroma cacao] Length = 419 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/43 (69%), Positives = 31/43 (72%) Frame = +1 Query: 97 SLAFLCLFLLIPFSAFAAPPHTLLFQGFNWESSNKAGRWYNEL 225 SL FL LFL I F A +P TLLFQGFNWES NKAG WYN L Sbjct: 6 SLCFLSLFLYI-FPALTSP--TLLFQGFNWESCNKAGGWYNSL 45