BLASTX nr result
ID: Catharanthus22_contig00037928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00037928 (214 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002262623.2| PREDICTED: uncharacterized protein LOC100242... 58 1e-06 emb|CBI21908.3| unnamed protein product [Vitis vinifera] 58 1e-06 emb|CAN60169.1| hypothetical protein VITISV_003665 [Vitis vinifera] 58 1e-06 gb|ESW06950.1| hypothetical protein PHAVU_010G089800g [Phaseolus... 57 3e-06 >ref|XP_002262623.2| PREDICTED: uncharacterized protein LOC100242390 [Vitis vinifera] Length = 450 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/54 (55%), Positives = 36/54 (66%), Gaps = 2/54 (3%) Frame = -3 Query: 212 DDLLNETSDVINTKSISPLQEAKPASSNFL--SAPHSDSKSKVLDDFDSWLDTI 57 DDLL ETS++++ P Q+AKP S S+ HS SKVLDDFDSWLDTI Sbjct: 397 DDLLEETSNLMDQNGTKPPQQAKPTSPGIQCSSSSHSGQGSKVLDDFDSWLDTI 450 >emb|CBI21908.3| unnamed protein product [Vitis vinifera] Length = 453 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/54 (55%), Positives = 36/54 (66%), Gaps = 2/54 (3%) Frame = -3 Query: 212 DDLLNETSDVINTKSISPLQEAKPASSNFL--SAPHSDSKSKVLDDFDSWLDTI 57 DDLL ETS++++ P Q+AKP S S+ HS SKVLDDFDSWLDTI Sbjct: 400 DDLLEETSNLMDQNGTKPPQQAKPTSPGIQCSSSSHSGQGSKVLDDFDSWLDTI 453 >emb|CAN60169.1| hypothetical protein VITISV_003665 [Vitis vinifera] Length = 484 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/54 (55%), Positives = 36/54 (66%), Gaps = 2/54 (3%) Frame = -3 Query: 212 DDLLNETSDVINTKSISPLQEAKPASSNFL--SAPHSDSKSKVLDDFDSWLDTI 57 DDLL ETS++++ P Q+AKP S S+ HS SKVLDDFDSWLDTI Sbjct: 431 DDLLEETSNLMDQNGTKPPQQAKPTSPGIQCSSSSHSGQGSKVLDDFDSWLDTI 484 >gb|ESW06950.1| hypothetical protein PHAVU_010G089800g [Phaseolus vulgaris] Length = 407 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/52 (53%), Positives = 33/52 (63%) Frame = -3 Query: 212 DDLLNETSDVINTKSISPLQEAKPASSNFLSAPHSDSKSKVLDDFDSWLDTI 57 DDLL ETS VI + QE KP + + S+ H SKSKV DDFDSW DT+ Sbjct: 356 DDLLEETSTVIKPNVLLLPQEEKPVNHSMKSSSHPGSKSKVTDDFDSWFDTL 407