BLASTX nr result
ID: Catharanthus22_contig00037351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00037351 (277 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB78008.1| putative protein [Arabidopsis thaliana] gi|73210... 63 5e-08 gb|AAD37021.1| putative non-LTR retrolelement reverse transcript... 62 6e-08 gb|ABW81175.1| non-LTR retrotransposon transposase [Arabidopsis ... 59 7e-07 gb|AAC63844.1| putative non-LTR retroelement reverse transcripta... 59 7e-07 gb|AAC26674.1| putative non-LTR retroelement reverse transcripta... 56 6e-06 >emb|CAB78008.1| putative protein [Arabidopsis thaliana] gi|7321072|emb|CAB82119.1| putative protein [Arabidopsis thaliana] Length = 947 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/60 (46%), Positives = 42/60 (70%) Frame = +2 Query: 23 IIRSFCMLSGQKVIIYKSRLFVSNNVSKQTALALSNNFGIPHTQDLGKYLRIPLFQRKVN 202 I+ +FC+ SGQKV + KS++F S NVS+ +S GI T++LGKYL +P+ QR++N Sbjct: 379 ILETFCIASGQKVSLDKSKIFFSKNVSRDLEKLISKESGIKSTRELGKYLGMPILQRRIN 438 >gb|AAD37021.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis thaliana] Length = 732 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/60 (45%), Positives = 42/60 (70%) Frame = +2 Query: 23 IIRSFCMLSGQKVIIYKSRLFVSNNVSKQTALALSNNFGIPHTQDLGKYLRIPLFQRKVN 202 ++ FC+ SGQKV + KS++F S NVS+ +S+ GI T++LGKYL +P+ QR++N Sbjct: 227 VLERFCVASGQKVSLEKSKIFFSENVSRDLGKLISDESGISSTRELGKYLGMPVLQRRIN 286 >gb|ABW81175.1| non-LTR retrotransposon transposase [Arabidopsis cebennensis] Length = 799 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/60 (41%), Positives = 41/60 (68%) Frame = +2 Query: 23 IIRSFCMLSGQKVIIYKSRLFVSNNVSKQTALALSNNFGIPHTQDLGKYLRIPLFQRKVN 202 ++ FC+ SGQKV + KS++F S NV + +S+ GI T++LGKYL +P+ Q+++N Sbjct: 157 VLEKFCIASGQKVSLEKSKIFFSQNVHRDLEKFISDESGIKSTKELGKYLGMPVLQKRIN 216 >gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1231 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/60 (43%), Positives = 42/60 (70%) Frame = +2 Query: 23 IIRSFCMLSGQKVIIYKSRLFVSNNVSKQTALALSNNFGIPHTQDLGKYLRIPLFQRKVN 202 ++ FC SGQKV + KS++F S+NVS++ +S GI T++LGKYL +P+ Q+++N Sbjct: 565 VLERFCEASGQKVSLEKSKIFFSHNVSREMEQLISEESGIGCTKELGKYLGMPILQKRMN 624 >gb|AAC26674.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 970 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/60 (41%), Positives = 39/60 (65%) Frame = +2 Query: 23 IIRSFCMLSGQKVIIYKSRLFVSNNVSKQTALALSNNFGIPHTQDLGKYLRIPLFQRKVN 202 ++ FC SGQ V + KS++ SNNVS+ +S GI T++LGKYL +P+ Q+++N Sbjct: 397 VLEQFCEASGQNVSLEKSKIVFSNNVSRDMERLISGESGIGCTRELGKYLGMPILQKRMN 456