BLASTX nr result
ID: Catharanthus22_contig00037125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00037125 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535451.1| conserved hypothetical protein [Ricinus comm... 117 2e-24 ref|XP_002523280.1| conserved hypothetical protein [Ricinus comm... 76 5e-12 ref|XP_006837223.1| hypothetical protein AMTR_s00105p00134620 [A... 59 5e-07 gb|EXB55384.1| hypothetical protein L484_016751 [Morus notabilis] 57 2e-06 >ref|XP_002535451.1| conserved hypothetical protein [Ricinus communis] gi|223523062|gb|EEF26930.1| conserved hypothetical protein [Ricinus communis] Length = 115 Score = 117 bits (292), Expect = 2e-24 Identities = 56/59 (94%), Positives = 56/59 (94%) Frame = -3 Query: 178 RGVSTSLARGWDSFTCIPASTTKSSGLNNPTTAVQPFLGFVESGFPFTHNGGTAPTRQA 2 RGVSTSLARGWDSFTCIPASTTKSSGLN TTAVQPFLGFVESGFPFTHNGG APTRQA Sbjct: 20 RGVSTSLARGWDSFTCIPASTTKSSGLNALTTAVQPFLGFVESGFPFTHNGGAAPTRQA 78 >ref|XP_002523280.1| conserved hypothetical protein [Ricinus communis] gi|223537493|gb|EEF39119.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 75.9 bits (185), Expect = 5e-12 Identities = 37/45 (82%), Positives = 38/45 (84%) Frame = -3 Query: 175 GVSTSLARGWDSFTCIPASTTKSSGLNNPTTAVQPFLGFVESGFP 41 G STSLARGWDSFTCI ASTTKSS LN TT VQPFL F+ESGFP Sbjct: 24 GRSTSLARGWDSFTCISASTTKSSSLNALTTLVQPFLEFIESGFP 68 >ref|XP_006837223.1| hypothetical protein AMTR_s00105p00134620 [Amborella trichopoda] gi|548839820|gb|ERN00077.1| hypothetical protein AMTR_s00105p00134620 [Amborella trichopoda] Length = 78 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +3 Query: 15 GAVPPLWVNGKPDSTNPRKGCTAVVGLLRPELF 113 GA PPL VNGKPDSTNPRKG VVG+LRPELF Sbjct: 10 GAAPPLRVNGKPDSTNPRKGSATVVGVLRPELF 42 >gb|EXB55384.1| hypothetical protein L484_016751 [Morus notabilis] Length = 91 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 79 VQPFLGFVESGFPFTHNGGTAPTRQA 2 VQPFLGFVESGFPFTHNGG APTRQA Sbjct: 44 VQPFLGFVESGFPFTHNGGAAPTRQA 69