BLASTX nr result
ID: Catharanthus22_contig00036108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00036108 (219 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_588284.1| hypothetical protein ZeamMp020 [Zea mays subsp.... 62 8e-08 gb|AFW86835.1| hypothetical protein ZEAMMB73_214691 [Zea mays] 56 6e-06 >ref|YP_588284.1| hypothetical protein ZeamMp020 [Zea mays subsp. mays] gi|94502700|ref|YP_588308.1| hypothetical protein ZeamMp046 [Zea mays subsp. mays] gi|40795138|gb|AAR91182.1| hypothetical protein (mitochondrion) [Zea mays] gi|40795139|gb|AAR91183.1| hypothetical protein (mitochondrion) [Zea mays] Length = 99 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -1 Query: 168 PNPFLRRAVYCK*SEPAWSKPPIEASEVGEPYDGQLSPAVRRGLSC 31 PNPF+ + + P S PP+EASEVGEPYDGQLSPAVRRGLSC Sbjct: 55 PNPFVGPCIVSDPNLPGAS-PPLEASEVGEPYDGQLSPAVRRGLSC 99 >gb|AFW86835.1| hypothetical protein ZEAMMB73_214691 [Zea mays] Length = 77 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -1 Query: 165 NPFLRRAVYCK*SEPAWSKPPIEASEVGEPYDGQLSPAVRRGLS 34 NPF+ + + P S PP+EASEVGEPYDGQLSPAVRRGLS Sbjct: 34 NPFVGPCIVSDPNLPGAS-PPLEASEVGEPYDGQLSPAVRRGLS 76