BLASTX nr result
ID: Catharanthus22_contig00036106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00036106 (216 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006491693.1| PREDICTED: uncharacterized protein LOC102612... 74 2e-11 ref|XP_006485453.1| PREDICTED: uncharacterized protein LOC102624... 72 8e-11 >ref|XP_006491693.1| PREDICTED: uncharacterized protein LOC102612426 [Citrus sinensis] Length = 242 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/69 (47%), Positives = 48/69 (69%) Frame = -1 Query: 207 GHLKFTTERDNERYKIVCSRPILPCQYIHHLTMETLNIKDSVIVLIGNIGWKNYFAINCP 28 G L FTT+++ ERYK + R ILP +YIH+ T+E LNIKD+ LI IG + + ++C Sbjct: 13 GCLTFTTQQEKERYKDISKRKILPAKYIHYPTLEKLNIKDNFNFLIDKIGLRKFVDVDCL 72 Query: 27 AYIDLVREF 1 Y++L+REF Sbjct: 73 GYVELIREF 81 >ref|XP_006485453.1| PREDICTED: uncharacterized protein LOC102624051 [Citrus sinensis] Length = 274 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/69 (44%), Positives = 48/69 (69%) Frame = -1 Query: 207 GHLKFTTERDNERYKIVCSRPILPCQYIHHLTMETLNIKDSVIVLIGNIGWKNYFAINCP 28 G L FTT+++ ERYK + R ILP +YIH+ T+E LN+KD+ L+ IG + + ++C Sbjct: 187 GCLTFTTQQEKERYKDISKRKILPAKYIHYPTLEKLNVKDNFNSLMDKIGLRKFVDVDCL 246 Query: 27 AYIDLVREF 1 Y++L+REF Sbjct: 247 GYVELIREF 255