BLASTX nr result
ID: Catharanthus22_contig00036050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00036050 (465 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006484352.1| PREDICTED: cytochrome P450 85A1-like [Citrus... 70 2e-10 ref|XP_006437886.1| hypothetical protein CICLE_v10031449mg [Citr... 65 7e-09 ref|XP_004491895.1| PREDICTED: cytochrome P450 85A-like [Cicer a... 64 2e-08 gb|EOY03776.1| Brassinosteroid-6-oxidase 2 [Theobroma cacao] 62 8e-08 gb|EMJ16611.1| hypothetical protein PRUPE_ppa005994mg [Prunus pe... 62 8e-08 dbj|BAF56235.1| cytochrome P450 enzyme [Pisum sativum] 62 1e-07 gb|EXB77660.1| Cytochrome P450 85A [Morus notabilis] 61 2e-07 ref|XP_004304211.1| PREDICTED: cytochrome P450 85A-like [Fragari... 60 2e-07 gb|ACR20476.1| steroid C-6 oxidase [Gossypium hirsutum] 60 2e-07 ref|XP_002305393.1| hypothetical protein POPTR_0004s11680g [Popu... 60 2e-07 gb|ESW23371.1| hypothetical protein PHAVU_004G041700g [Phaseolus... 60 3e-07 ref|XP_004507293.1| PREDICTED: cytochrome P450 85A-like [Cicer a... 60 3e-07 ref|NP_001267889.1| brassinosteroid-6-oxidase [Vitis vinifera] g... 60 3e-07 ref|XP_003598105.1| Cytochrome P450 85A1 [Medicago truncatula] g... 60 3e-07 emb|CBI16941.3| unnamed protein product [Vitis vinifera] 60 3e-07 emb|CAN66537.1| hypothetical protein VITISV_029635 [Vitis vinifera] 60 3e-07 ref|XP_003554965.1| PREDICTED: cytochrome P450 85A-like [Glycine... 60 4e-07 ref|XP_006856402.1| hypothetical protein AMTR_s00047p00210610 [A... 59 5e-07 ref|XP_004507292.1| PREDICTED: cytochrome P450 85A-like [Cicer a... 59 7e-07 ref|XP_006290963.1| hypothetical protein CARUB_v10017078mg, part... 59 7e-07 >ref|XP_006484352.1| PREDICTED: cytochrome P450 85A1-like [Citrus sinensis] Length = 465 Score = 70.5 bits (171), Expect = 2e-10 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -1 Query: 120 CLILGVSYIYHSLLKWNEMKYRQKGLPPGTMGWPVFGET 4 CL+LG S++ +LLKWNE++YR +GLPPGTMGWPVFGET Sbjct: 10 CLVLGFSFLCFALLKWNEIRYRGEGLPPGTMGWPVFGET 48 >ref|XP_006437886.1| hypothetical protein CICLE_v10031449mg [Citrus clementina] gi|557540082|gb|ESR51126.1| hypothetical protein CICLE_v10031449mg [Citrus clementina] Length = 465 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -1 Query: 120 CLILGVSYIYHSLLKWNEMKYRQKGLPPGTMGWPVFGET 4 CL+LG S++ +LLKWNE++YR +GLPPGTMG PVFGET Sbjct: 10 CLVLGFSFLCFALLKWNEIRYRGEGLPPGTMGCPVFGET 48 >ref|XP_004491895.1| PREDICTED: cytochrome P450 85A-like [Cicer arietinum] Length = 464 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/41 (65%), Positives = 36/41 (87%), Gaps = 3/41 (7%) Frame = -1 Query: 117 LILGVSYIY---HSLLKWNEMKYRQKGLPPGTMGWPVFGET 4 +ILGV++++ +LLKWNE++YR+KGLP GTMGWPVFGET Sbjct: 6 IILGVAFVFCFCSALLKWNEVRYRRKGLPQGTMGWPVFGET 46 >gb|EOY03776.1| Brassinosteroid-6-oxidase 2 [Theobroma cacao] Length = 465 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 117 LILGVSYIYHSLLKWNEMKYRQKGLPPGTMGWPVFGET 4 L + V I +LL+WNEM+YR+KGLPPGTMGWPVFGET Sbjct: 10 LFVLVLCICTALLRWNEMRYRKKGLPPGTMGWPVFGET 47 >gb|EMJ16611.1| hypothetical protein PRUPE_ppa005994mg [Prunus persica] Length = 433 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 114 ILGVSYIYHSLLKWNEMKYRQKGLPPGTMGWPVFGET 4 +L V I +LL+WNE++YR+KGLPPGTMGWPVFGET Sbjct: 10 VLFVLCICSALLRWNEVRYRKKGLPPGTMGWPVFGET 46 >dbj|BAF56235.1| cytochrome P450 enzyme [Pisum sativum] Length = 466 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/41 (65%), Positives = 34/41 (82%), Gaps = 3/41 (7%) Frame = -1 Query: 117 LILGVSYIY---HSLLKWNEMKYRQKGLPPGTMGWPVFGET 4 +I GV +I +LL+WNE++YR+KGLPPGTMGWPVFGET Sbjct: 6 VIFGVFFILCLCSALLRWNEVRYRKKGLPPGTMGWPVFGET 46 >gb|EXB77660.1| Cytochrome P450 85A [Morus notabilis] Length = 465 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -1 Query: 87 SLLKWNEMKYRQKGLPPGTMGWPVFGET 4 +LLKWNE++YR+KGLPPGTMGWP+FGET Sbjct: 20 ALLKWNEVRYRKKGLPPGTMGWPIFGET 47 >ref|XP_004304211.1| PREDICTED: cytochrome P450 85A-like [Fragaria vesca subsp. vesca] Length = 478 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 114 ILGVSYIYHSLLKWNEMKYRQKGLPPGTMGWPVFGET 4 +L V +LL+WNE++YR+KGLPPGTMGWPVFGET Sbjct: 23 VLFVLCFCSALLRWNEVRYRKKGLPPGTMGWPVFGET 59 >gb|ACR20476.1| steroid C-6 oxidase [Gossypium hirsutum] Length = 465 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -1 Query: 87 SLLKWNEMKYRQKGLPPGTMGWPVFGET 4 ++L+WNEM+YR+KGLPPGTMGWPVFGET Sbjct: 20 AVLRWNEMRYRKKGLPPGTMGWPVFGET 47 >ref|XP_002305393.1| hypothetical protein POPTR_0004s11680g [Populus trichocarpa] gi|222848357|gb|EEE85904.1| hypothetical protein POPTR_0004s11680g [Populus trichocarpa] Length = 464 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -1 Query: 117 LILGVSYIYHSLLKWNEMKYRQKGLPPGTMGWPVFGET 4 ++L + I +LL+WNE++YR+KGLPPGTMGWP+FGET Sbjct: 10 VVLFLFGISSALLRWNEVRYRKKGLPPGTMGWPIFGET 47 >gb|ESW23371.1| hypothetical protein PHAVU_004G041700g [Phaseolus vulgaris] Length = 463 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -1 Query: 87 SLLKWNEMKYRQKGLPPGTMGWPVFGET 4 +LL+WNE++YR+KGLPPGTMGWPVFGET Sbjct: 19 ALLRWNEVRYRKKGLPPGTMGWPVFGET 46 >ref|XP_004507293.1| PREDICTED: cytochrome P450 85A-like [Cicer arietinum] Length = 464 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/41 (60%), Positives = 34/41 (82%), Gaps = 3/41 (7%) Frame = -1 Query: 114 ILGVSYI---YHSLLKWNEMKYRQKGLPPGTMGWPVFGETL 1 I+GV + + LL+WNE++Y++KGLPPGTMGWPVFGET+ Sbjct: 7 IVGVFLVLCFFSILLRWNELRYKKKGLPPGTMGWPVFGETI 47 >ref|NP_001267889.1| brassinosteroid-6-oxidase [Vitis vinifera] gi|81239117|gb|ABB60086.1| brassinosteroid-6-oxidase [Vitis vinifera] Length = 460 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -1 Query: 87 SLLKWNEMKYRQKGLPPGTMGWPVFGET 4 +LL+WNE++YR+KGLPPGTMGWPVFGET Sbjct: 16 ALLRWNEVRYRKKGLPPGTMGWPVFGET 43 >ref|XP_003598105.1| Cytochrome P450 85A1 [Medicago truncatula] gi|355487153|gb|AES68356.1| Cytochrome P450 85A1 [Medicago truncatula] Length = 464 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -1 Query: 87 SLLKWNEMKYRQKGLPPGTMGWPVFGET 4 +LL+WNE++YR+KGLPPGTMGWPVFGET Sbjct: 19 ALLRWNEVRYRKKGLPPGTMGWPVFGET 46 >emb|CBI16941.3| unnamed protein product [Vitis vinifera] Length = 464 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -1 Query: 87 SLLKWNEMKYRQKGLPPGTMGWPVFGET 4 +LL+WNE++YR+KGLPPGTMGWPVFGET Sbjct: 20 ALLRWNEVRYRKKGLPPGTMGWPVFGET 47 >emb|CAN66537.1| hypothetical protein VITISV_029635 [Vitis vinifera] Length = 463 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -1 Query: 87 SLLKWNEMKYRQKGLPPGTMGWPVFGET 4 +LL+WNE++YR+KGLPPGTMGWPVFGET Sbjct: 16 ALLRWNEVRYRKKGLPPGTMGWPVFGET 43 >ref|XP_003554965.1| PREDICTED: cytochrome P450 85A-like [Glycine max] Length = 465 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 3/43 (6%) Frame = -1 Query: 123 ACLILGVSYIY---HSLLKWNEMKYRQKGLPPGTMGWPVFGET 4 A +++GV + +LL+WNE++YR+KGLPPGTMGWP+FGET Sbjct: 6 AIVVVGVVLVLCFCSALLRWNEVRYRKKGLPPGTMGWPLFGET 48 >ref|XP_006856402.1| hypothetical protein AMTR_s00047p00210610 [Amborella trichopoda] gi|548860262|gb|ERN17869.1| hypothetical protein AMTR_s00047p00210610 [Amborella trichopoda] Length = 469 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/28 (78%), Positives = 28/28 (100%) Frame = -1 Query: 87 SLLKWNEMKYRQKGLPPGTMGWPVFGET 4 ++LKWNE++YR+KGLPPGTMGWP+FGET Sbjct: 23 AMLKWNEVRYRKKGLPPGTMGWPLFGET 50 >ref|XP_004507292.1| PREDICTED: cytochrome P450 85A-like [Cicer arietinum] Length = 465 Score = 58.9 bits (141), Expect = 7e-07 Identities = 22/28 (78%), Positives = 28/28 (100%) Frame = -1 Query: 87 SLLKWNEMKYRQKGLPPGTMGWPVFGET 4 +LL+WNE++YR+KGLPPGTMGWP+FGET Sbjct: 19 ALLRWNEVRYRKKGLPPGTMGWPLFGET 46 >ref|XP_006290963.1| hypothetical protein CARUB_v10017078mg, partial [Capsella rubella] gi|482559670|gb|EOA23861.1| hypothetical protein CARUB_v10017078mg, partial [Capsella rubella] Length = 496 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -1 Query: 117 LILGVSYIYHSLLKWNEMKYRQKGLPPGTMGWPVFGET 4 L++ + I +LL+WN+M+Y +KGLPPGTMGWP+FGET Sbjct: 41 LLVIIVCICSALLRWNQMRYSKKGLPPGTMGWPIFGET 78