BLASTX nr result
ID: Catharanthus22_contig00035676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00035676 (285 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY23232.1| ATP binding protein, putative [Theobroma cacao] 55 7e-06 >gb|EOY23232.1| ATP binding protein, putative [Theobroma cacao] Length = 542 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -2 Query: 284 CWPWRALKSNAANTTTSSRVSHVKRMIPEMQALLH 180 CWPWRALK N N T ++RV VKRM+PEMQALLH Sbjct: 506 CWPWRALKMNITNNT-NNRVQDVKRMLPEMQALLH 539