BLASTX nr result
ID: Catharanthus22_contig00035306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00035306 (505 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006595075.1| PREDICTED: small G protein signaling modulat... 59 5e-07 ref|XP_006595072.1| PREDICTED: small G protein signaling modulat... 59 5e-07 emb|CBI29559.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_006349579.1| PREDICTED: small G protein signaling modulat... 59 7e-07 ref|XP_004234775.1| PREDICTED: uncharacterized protein LOC101251... 58 1e-06 ref|XP_006597213.1| PREDICTED: small G protein signaling modulat... 57 2e-06 ref|XP_006597209.1| PREDICTED: small G protein signaling modulat... 57 2e-06 ref|XP_003546981.1| PREDICTED: small G protein signaling modulat... 57 2e-06 ref|XP_002534076.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 ref|XP_006595074.1| PREDICTED: small G protein signaling modulat... 56 6e-06 >ref|XP_006595075.1| PREDICTED: small G protein signaling modulator 1-like isoform X4 [Glycine max] Length = 700 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +1 Query: 1 QWKCGKGAAVNLQGLSSIVRDIGEPCLHQTPIKDVS*VDSVLK 129 QW CGK AVNL+ +SSIVRDIG+PCL Q+P+K V V+ +LK Sbjct: 9 QWSCGKAGAVNLRKVSSIVRDIGDPCLSQSPVKVVLTVNRMLK 51 >ref|XP_006595072.1| PREDICTED: small G protein signaling modulator 1-like isoform X1 [Glycine max] gi|571503204|ref|XP_006595073.1| PREDICTED: small G protein signaling modulator 1-like isoform X2 [Glycine max] Length = 770 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +1 Query: 1 QWKCGKGAAVNLQGLSSIVRDIGEPCLHQTPIKDVS*VDSVLK 129 QW CGK AVNL+ +SSIVRDIG+PCL Q+P+K V V+ +LK Sbjct: 79 QWSCGKAGAVNLRKVSSIVRDIGDPCLSQSPVKVVLTVNRMLK 121 >emb|CBI29559.3| unnamed protein product [Vitis vinifera] Length = 119 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +1 Query: 1 QWKCGKGAAVNLQGLSSIVRDIGEPCLHQTPIK 99 QW CGK +++NLQ +S+IVRDIGEPCLHQ+PIK Sbjct: 9 QWSCGKASSMNLQKVSAIVRDIGEPCLHQSPIK 41 >ref|XP_006349579.1| PREDICTED: small G protein signaling modulator 1-like isoform X1 [Solanum tuberosum] gi|565365784|ref|XP_006349580.1| PREDICTED: small G protein signaling modulator 1-like isoform X2 [Solanum tuberosum] Length = 691 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 4 WKCGKGAAVNLQGLSSIVRDIGEPCLHQTPIK 99 WKCGKG VNLQ ++SIVRDIGEPCLHQ+ IK Sbjct: 10 WKCGKGGTVNLQKVTSIVRDIGEPCLHQSSIK 41 >ref|XP_004234775.1| PREDICTED: uncharacterized protein LOC101251361 [Solanum lycopersicum] Length = 692 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 4 WKCGKGAAVNLQGLSSIVRDIGEPCLHQTPIK 99 WKCGKG VNLQ ++SIVRDIGEPCLHQ+ IK Sbjct: 10 WKCGKGGTVNLQKVTSIVRDIGEPCLHQSLIK 41 >ref|XP_006597213.1| PREDICTED: small G protein signaling modulator 1-like isoform X6 [Glycine max] Length = 662 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +1 Query: 1 QWKCGKGAAVNLQGLSSIVRDIGEPCLHQTPIKDVS*VDSVLK 129 QW CGK A NL+ +SSIVRDIG+PCL Q+P+K V V+ +LK Sbjct: 9 QWTCGKAGAANLRKVSSIVRDIGDPCLSQSPVKVVVTVNRMLK 51 >ref|XP_006597209.1| PREDICTED: small G protein signaling modulator 1-like isoform X2 [Glycine max] gi|571515162|ref|XP_006597210.1| PREDICTED: small G protein signaling modulator 1-like isoform X3 [Glycine max] gi|571515166|ref|XP_006597211.1| PREDICTED: small G protein signaling modulator 1-like isoform X4 [Glycine max] Length = 703 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +1 Query: 1 QWKCGKGAAVNLQGLSSIVRDIGEPCLHQTPIKDVS*VDSVLK 129 QW CGK A NL+ +SSIVRDIG+PCL Q+P+K V V+ +LK Sbjct: 9 QWTCGKAGAANLRKVSSIVRDIGDPCLSQSPVKVVVTVNRMLK 51 >ref|XP_003546981.1| PREDICTED: small G protein signaling modulator 1-like isoform X1 [Glycine max] Length = 699 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +1 Query: 1 QWKCGKGAAVNLQGLSSIVRDIGEPCLHQTPIKDVS*VDSVLK 129 QW CGK A NL+ +SSIVRDIG+PCL Q+P+K V V+ +LK Sbjct: 9 QWTCGKAGAANLRKVSSIVRDIGDPCLSQSPVKVVVTVNRMLK 51 >ref|XP_002534076.1| conserved hypothetical protein [Ricinus communis] gi|223525888|gb|EEF28308.1| conserved hypothetical protein [Ricinus communis] Length = 662 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 1 QWKCGKGAAVNLQGLSSIVRDIGEPCLHQTPIK 99 QW CGK AVNLQ + SIVRDIGEPCL Q+PIK Sbjct: 10 QWSCGKPGAVNLQRVGSIVRDIGEPCLAQSPIK 42 >ref|XP_006595074.1| PREDICTED: small G protein signaling modulator 1-like isoform X3 [Glycine max] Length = 766 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 1 QWKCGKGAAVNLQGLSSIVRDIGEPCLHQTPIK 99 QW CGK AVNL+ +SSIVRDIG+PCL Q+P+K Sbjct: 79 QWSCGKAGAVNLRKVSSIVRDIGDPCLSQSPVK 111