BLASTX nr result
ID: Catharanthus22_contig00035059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00035059 (349 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82105.1| hypothetical protein VITISV_002577 [Vitis vinifera] 41 1e-07 >emb|CAN82105.1| hypothetical protein VITISV_002577 [Vitis vinifera] Length = 1109 Score = 41.2 bits (95), Expect(2) = 1e-07 Identities = 21/57 (36%), Positives = 31/57 (54%) Frame = -2 Query: 324 TLLTILNTQPSNTDKMSGKVDFALNWILDSSCSRRMTVRRAYLTNLRSTLPYVIGLP 154 TLLT+LN+ S ++M L WI+D+ MT L +LR +P ++GLP Sbjct: 170 TLLTMLNSHKSGANZMLTGKQNILPWIIDTGAXHHMTGTYECLNDLRDIMPCLVGLP 226 Score = 40.0 bits (92), Expect(2) = 1e-07 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = -1 Query: 154 NGSEAVDTQQGRTSLGPNFPVDNVLFILQLRCNLISLAQLLKDSN 20 NG+E ++ +LG + +VLF+ +L+CNLI + QLL DSN Sbjct: 227 NGAETKALKERTVTLGEKLKLRHVLFVPKLKCNLIFVLQLLDDSN 271