BLASTX nr result
ID: Catharanthus22_contig00035050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00035050 (314 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004985835.1| PREDICTED: sorcin-like isoform X1 [Setaria i... 58 1e-06 emb|CAN67615.1| hypothetical protein VITISV_011123 [Vitis vinifera] 56 4e-06 >ref|XP_004985835.1| PREDICTED: sorcin-like isoform X1 [Setaria italica] Length = 183 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 1 RNLFNSFDTSKQGRVSLDLNQFIYCSECIHLNSVLDLLY 117 RN+FNSFDTSKQGRVSLD NQF+YCSE + + LLY Sbjct: 139 RNMFNSFDTSKQGRVSLDFNQFVYCSEFLFPVPISLLLY 177 >emb|CAN67615.1| hypothetical protein VITISV_011123 [Vitis vinifera] Length = 122 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +1 Query: 1 RNLFNSFDTSKQGRVSLDLNQFIYCSE 81 RNLFNSFDT+KQGRV+LDLNQF+YCSE Sbjct: 92 RNLFNSFDTAKQGRVTLDLNQFVYCSE 118