BLASTX nr result
ID: Catharanthus22_contig00034621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00034621 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284318.1| PREDICTED: formamidase [Vitis vinifera] gi|2... 66 4e-09 emb|CAN78134.1| hypothetical protein VITISV_034053 [Vitis vinifera] 66 4e-09 gb|EPS64323.1| hypothetical protein M569_10458, partial [Genlise... 66 5e-09 ref|XP_003632495.1| PREDICTED: formamidase [Vitis vinifera] 66 5e-09 ref|XP_002284306.1| PREDICTED: formamidase isoform 1 [Vitis vini... 66 5e-09 ref|XP_002284310.1| PREDICTED: formamidase isoform 2 [Vitis vini... 66 5e-09 emb|CAN78133.1| hypothetical protein VITISV_034052 [Vitis vinifera] 66 5e-09 gb|EXB25088.1| hypothetical protein L484_005911 [Morus notabilis] 65 7e-09 ref|XP_006466481.1| PREDICTED: putative formamidase C869.04-like... 65 1e-08 ref|XP_006466480.1| PREDICTED: putative formamidase C869.04-like... 65 1e-08 ref|XP_006426068.1| hypothetical protein CICLE_v10025794mg [Citr... 65 1e-08 ref|XP_006426067.1| hypothetical protein CICLE_v10025794mg [Citr... 65 1e-08 ref|XP_006426066.1| hypothetical protein CICLE_v10025794mg [Citr... 65 1e-08 ref|XP_002307296.2| hypothetical protein POPTR_0005s18890g [Popu... 65 1e-08 ref|XP_002307297.2| hypothetical protein POPTR_0005s18890g [Popu... 65 1e-08 gb|EMS51565.1| Formamidase [Triticum urartu] 64 2e-08 gb|EMJ06380.1| hypothetical protein PRUPE_ppa005607mg [Prunus pe... 64 2e-08 ref|NP_568028.1| acetamidase/formamidase family protein [Arabido... 64 2e-08 ref|NP_001190945.1| acetamidase/formamidase family protein [Arab... 64 2e-08 ref|XP_003632494.1| PREDICTED: formamidase-like isoform 2 [Vitis... 64 2e-08 >ref|XP_002284318.1| PREDICTED: formamidase [Vitis vinifera] gi|296087333|emb|CBI33707.3| unnamed protein product [Vitis vinifera] Length = 451 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQ+GTPEWE++AREAARTIPGRENGGNCDIK Sbjct: 217 IQQGTPEWERIAREAARTIPGRENGGNCDIK 247 >emb|CAN78134.1| hypothetical protein VITISV_034053 [Vitis vinifera] Length = 487 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQ+GTPEWE++AREAARTIPGRENGGNCDIK Sbjct: 253 IQQGTPEWERIAREAARTIPGRENGGNCDIK 283 >gb|EPS64323.1| hypothetical protein M569_10458, partial [Genlisea aurea] Length = 377 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 I+EGTPEWE++AREAARTIPGRENGGNCDIK Sbjct: 217 IREGTPEWERIAREAARTIPGRENGGNCDIK 247 >ref|XP_003632495.1| PREDICTED: formamidase [Vitis vinifera] Length = 431 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQ+GTPEWE++AREAARTIPGRENGGNCDIK Sbjct: 197 IQKGTPEWERIAREAARTIPGRENGGNCDIK 227 >ref|XP_002284306.1| PREDICTED: formamidase isoform 1 [Vitis vinifera] Length = 451 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQ+GTPEWE++AREAARTIPGRENGGNCDIK Sbjct: 217 IQKGTPEWERIAREAARTIPGRENGGNCDIK 247 >ref|XP_002284310.1| PREDICTED: formamidase isoform 2 [Vitis vinifera] gi|296087335|emb|CBI33709.3| unnamed protein product [Vitis vinifera] Length = 451 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQ+GTPEWE++AREAARTIPGRENGGNCDIK Sbjct: 217 IQKGTPEWERIAREAARTIPGRENGGNCDIK 247 >emb|CAN78133.1| hypothetical protein VITISV_034052 [Vitis vinifera] Length = 451 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQ+GTPEWE++AREAARTIPGRENGGNCDIK Sbjct: 217 IQKGTPEWERIAREAARTIPGRENGGNCDIK 247 >gb|EXB25088.1| hypothetical protein L484_005911 [Morus notabilis] Length = 454 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 I+EGTPEWEK+A+EAARTIPGRENGGNCDIK Sbjct: 217 IKEGTPEWEKIAQEAARTIPGRENGGNCDIK 247 >ref|XP_006466481.1| PREDICTED: putative formamidase C869.04-like isoform X2 [Citrus sinensis] Length = 395 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQEGTPEW+K+A EAARTIPGRENGGNCDIK Sbjct: 160 IQEGTPEWKKIAMEAARTIPGRENGGNCDIK 190 >ref|XP_006466480.1| PREDICTED: putative formamidase C869.04-like isoform X1 [Citrus sinensis] Length = 452 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQEGTPEW+K+A EAARTIPGRENGGNCDIK Sbjct: 217 IQEGTPEWKKIAMEAARTIPGRENGGNCDIK 247 >ref|XP_006426068.1| hypothetical protein CICLE_v10025794mg [Citrus clementina] gi|567866893|ref|XP_006426069.1| hypothetical protein CICLE_v10025794mg [Citrus clementina] gi|557528058|gb|ESR39308.1| hypothetical protein CICLE_v10025794mg [Citrus clementina] gi|557528059|gb|ESR39309.1| hypothetical protein CICLE_v10025794mg [Citrus clementina] Length = 395 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQEGTPEW+K+A EAARTIPGRENGGNCDIK Sbjct: 160 IQEGTPEWKKIAMEAARTIPGRENGGNCDIK 190 >ref|XP_006426067.1| hypothetical protein CICLE_v10025794mg [Citrus clementina] gi|567866897|ref|XP_006426071.1| hypothetical protein CICLE_v10025794mg [Citrus clementina] gi|557528057|gb|ESR39307.1| hypothetical protein CICLE_v10025794mg [Citrus clementina] gi|557528061|gb|ESR39311.1| hypothetical protein CICLE_v10025794mg [Citrus clementina] Length = 452 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQEGTPEW+K+A EAARTIPGRENGGNCDIK Sbjct: 217 IQEGTPEWKKIAMEAARTIPGRENGGNCDIK 247 >ref|XP_006426066.1| hypothetical protein CICLE_v10025794mg [Citrus clementina] gi|567866895|ref|XP_006426070.1| hypothetical protein CICLE_v10025794mg [Citrus clementina] gi|557528056|gb|ESR39306.1| hypothetical protein CICLE_v10025794mg [Citrus clementina] gi|557528060|gb|ESR39310.1| hypothetical protein CICLE_v10025794mg [Citrus clementina] Length = 445 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQEGTPEW+K+A EAARTIPGRENGGNCDIK Sbjct: 217 IQEGTPEWKKIAMEAARTIPGRENGGNCDIK 247 >ref|XP_002307296.2| hypothetical protein POPTR_0005s18890g [Populus trichocarpa] gi|550339272|gb|EEE94292.2| hypothetical protein POPTR_0005s18890g [Populus trichocarpa] Length = 451 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQ+GTPEWEK+A EAARTIPGRENGGNCDIK Sbjct: 217 IQKGTPEWEKIATEAARTIPGRENGGNCDIK 247 >ref|XP_002307297.2| hypothetical protein POPTR_0005s18890g [Populus trichocarpa] gi|550339271|gb|EEE94293.2| hypothetical protein POPTR_0005s18890g [Populus trichocarpa] Length = 312 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQ+GTPEWEK+A EAARTIPGRENGGNCDIK Sbjct: 217 IQKGTPEWEKIATEAARTIPGRENGGNCDIK 247 >gb|EMS51565.1| Formamidase [Triticum urartu] Length = 484 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQEGTPEW+++A EAARTIPGRENGGNCDIK Sbjct: 217 IQEGTPEWQRIANEAARTIPGRENGGNCDIK 247 >gb|EMJ06380.1| hypothetical protein PRUPE_ppa005607mg [Prunus persica] Length = 452 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 I+EGTPEWEK+A EAARTIPGRENGGNCDIK Sbjct: 217 IKEGTPEWEKIALEAARTIPGRENGGNCDIK 247 >ref|NP_568028.1| acetamidase/formamidase family protein [Arabidopsis thaliana] gi|222423035|dbj|BAH19500.1| AT4G37550 [Arabidopsis thaliana] gi|332661409|gb|AEE86809.1| acetamidase/formamidase family protein [Arabidopsis thaliana] Length = 452 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 I+EGTPEWE++A EAARTIPGRENGGNCDIK Sbjct: 217 IEEGTPEWERIANEAARTIPGRENGGNCDIK 247 >ref|NP_001190945.1| acetamidase/formamidase family protein [Arabidopsis thaliana] gi|4468980|emb|CAB38294.1| formamidase-like protein [Arabidopsis thaliana] gi|7270737|emb|CAB80420.1| formamidase-like protein [Arabidopsis thaliana] gi|332661411|gb|AEE86811.1| acetamidase/formamidase family protein [Arabidopsis thaliana] Length = 432 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 I+EGTPEWE++A EAARTIPGRENGGNCDIK Sbjct: 197 IEEGTPEWERIANEAARTIPGRENGGNCDIK 227 >ref|XP_003632494.1| PREDICTED: formamidase-like isoform 2 [Vitis vinifera] Length = 431 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 252 IQEGTPEWEKMAREAARTIPGRENGGNCDIK 344 IQ+GTPEWE++AREAART PGRENGGNCDIK Sbjct: 197 IQQGTPEWERIAREAARTTPGRENGGNCDIK 227