BLASTX nr result
ID: Catharanthus22_contig00034322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00034322 (274 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529456.1| conserved hypothetical protein [Ricinus comm... 69 6e-10 ref|XP_002529116.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 ref|XP_006374421.1| hypothetical protein POPTR_0015s07025g [Popu... 57 3e-06 >ref|XP_002529456.1| conserved hypothetical protein [Ricinus communis] gi|223531072|gb|EEF32922.1| conserved hypothetical protein [Ricinus communis] Length = 67 Score = 68.9 bits (167), Expect = 6e-10 Identities = 34/47 (72%), Positives = 35/47 (74%) Frame = +3 Query: 3 DNYPLWGEQVLALAESQDLISHLTGETTDQAKDSTTPIPTYSTNNKT 143 DNYPLW EQVLALAESQDLI HLT E + A DSTT T S NNKT Sbjct: 19 DNYPLWREQVLALAESQDLIDHLTSEINNSATDSTTQTETTSMNNKT 65 >ref|XP_002529116.1| conserved hypothetical protein [Ricinus communis] gi|223531395|gb|EEF33229.1| conserved hypothetical protein [Ricinus communis] Length = 92 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = +3 Query: 30 VLALAESQDLISHLTGETTDQAKDSTTPIPTYSTNNKTPE*RKSDRLL 173 VLA ESQDLI++LTGE + A DSTT T TNNKT + RKSDRLL Sbjct: 8 VLAFTESQDLINYLTGEINNSATDSTTQTETTLTNNKTADWRKSDRLL 55 >ref|XP_006374421.1| hypothetical protein POPTR_0015s07025g [Populus trichocarpa] gi|550322183|gb|ERP52218.1| hypothetical protein POPTR_0015s07025g [Populus trichocarpa] Length = 204 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/63 (52%), Positives = 37/63 (58%), Gaps = 7/63 (11%) Frame = +3 Query: 6 NYPLWGEQVLALAESQDLISHLTGETTDQAKDSTTPIPTYSTNNKTPE-------*RKSD 164 NYP W EQVL LAESQDL+ HLT ET Q K + T T N TP+ +KSD Sbjct: 20 NYPPWREQVLGLAESQDLVDHLTRETPIQTKYTIPDSNTTKTRNTTPQVTREFIAWQKSD 79 Query: 165 RLL 173 RLL Sbjct: 80 RLL 82