BLASTX nr result
ID: Catharanthus22_contig00033348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00033348 (293 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA49433.1| cytochrome P-450 [Catharanthus roseus] 91 2e-16 gb|ESW18604.1| hypothetical protein PHAVU_006G054700g [Phaseolus... 59 9e-07 gb|EMJ13617.1| hypothetical protein PRUPE_ppa016579mg [Prunus pe... 57 2e-06 gb|ESW18607.1| hypothetical protein PHAVU_006G055000g, partial [... 57 3e-06 gb|ESW18602.1| hypothetical protein PHAVU_006G054500g [Phaseolus... 57 3e-06 gb|EMJ15946.1| hypothetical protein PRUPE_ppa025066mg [Prunus pe... 56 4e-06 gb|ESW18285.1| hypothetical protein PHAVU_006G028100g [Phaseolus... 56 6e-06 ref|XP_002522903.1| cytochrome P450, putative [Ricinus communis]... 56 6e-06 ref|XP_002264048.2| PREDICTED: cytochrome P450 71D11-like [Vitis... 55 8e-06 emb|CBI39705.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002522900.1| cytochrome P450, putative [Ricinus communis]... 55 8e-06 >emb|CAA49433.1| cytochrome P-450 [Catharanthus roseus] Length = 61 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = -3 Query: 291 LYKLNWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSYYP 166 LY NWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSYYP Sbjct: 20 LYHFNWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSYYP 61 >gb|ESW18604.1| hypothetical protein PHAVU_006G054700g [Phaseolus vulgaris] Length = 508 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = -3 Query: 291 LYKLNWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSYYP*SIP 154 LY +W LP G+ SE LDMSE +GIT RK+DL L+P Y P S+P Sbjct: 463 LYHFDWKLPSGMISEELDMSEEFGITVRRKHDLFLVPFPYLPLSVP 508 >gb|EMJ13617.1| hypothetical protein PRUPE_ppa016579mg [Prunus persica] Length = 445 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = -3 Query: 291 LYKLNWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSYYP 166 LY +W LP+G+ E LDM+ET+G+T +K +LHLIPT Y+P Sbjct: 400 LYHFDWKLPNGMKQEGLDMTETFGVTVRKKEELHLIPTPYHP 441 >gb|ESW18607.1| hypothetical protein PHAVU_006G055000g, partial [Phaseolus vulgaris] Length = 313 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/46 (54%), Positives = 31/46 (67%) Frame = -3 Query: 291 LYKLNWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSYYP*SIP 154 LY +W LP G+ SE LDMSE +GIT RK+DL L+P Y P +P Sbjct: 268 LYHFDWKLPSGMISEELDMSEEFGITVRRKHDLFLVPFPYLPLPVP 313 >gb|ESW18602.1| hypothetical protein PHAVU_006G054500g [Phaseolus vulgaris] Length = 508 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/46 (54%), Positives = 31/46 (67%) Frame = -3 Query: 291 LYKLNWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSYYP*SIP 154 LY +W LP G+ SE LDMSE +GIT RK+DL L+P Y P +P Sbjct: 463 LYHFDWKLPSGMISEELDMSEEFGITVRRKHDLFLVPFPYIPLPVP 508 >gb|EMJ15946.1| hypothetical protein PRUPE_ppa025066mg [Prunus persica] Length = 514 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -3 Query: 291 LYKLNWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSYYP 166 LY +W LP+G+ E LDM+E +G T RK+DLHLIP Y+P Sbjct: 465 LYHFDWKLPNGMKHEDLDMTEAFGATVKRKHDLHLIPIPYHP 506 >gb|ESW18285.1| hypothetical protein PHAVU_006G028100g [Phaseolus vulgaris] Length = 507 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -3 Query: 291 LYKLNWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSYYP 166 LY +W LP G+ SE L+MSE +G+T RKYDL L+P Y+P Sbjct: 462 LYHFDWKLPSGMRSEELNMSEVFGVTMKRKYDLFLVPFPYHP 503 >ref|XP_002522903.1| cytochrome P450, putative [Ricinus communis] gi|223537888|gb|EEF39503.1| cytochrome P450, putative [Ricinus communis] Length = 532 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = -3 Query: 291 LYKLNWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSYYP 166 LY +W LPDG+ E LDM+ET+G T RK LH+IPT Y P Sbjct: 477 LYHFDWKLPDGIAPEDLDMTETFGATITRKNKLHVIPTRYQP 518 >ref|XP_002264048.2| PREDICTED: cytochrome P450 71D11-like [Vitis vinifera] Length = 485 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = -3 Query: 291 LYKLNWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSYYP 166 LY +W LP+G+ + LDM+E +G+ RK DL+LIPT+YYP Sbjct: 440 LYHFDWKLPNGMKQQDLDMTEVFGLAVRRKEDLYLIPTAYYP 481 >emb|CBI39705.3| unnamed protein product [Vitis vinifera] Length = 1345 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = -3 Query: 291 LYKLNWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSYYP 166 LY +W LP+G+ + LDM+E +G+ RK DL+LIPT+YYP Sbjct: 1300 LYHFDWKLPNGMKQQDLDMTEVFGLAVRRKEDLYLIPTAYYP 1341 >ref|XP_002522900.1| cytochrome P450, putative [Ricinus communis] gi|223537885|gb|EEF39500.1| cytochrome P450, putative [Ricinus communis] Length = 221 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = -3 Query: 291 LYKLNWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSYYP 166 LY +W LPDG+ E LDM+ET+G T RK LH+IPT Y P Sbjct: 166 LYHFDWKLPDGVAPEDLDMTETFGATITRKNKLHVIPTRYQP 207