BLASTX nr result
ID: Catharanthus22_contig00033267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00033267 (563 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350189.1| PREDICTED: uncharacterized protein LOC102605... 48 5e-07 ref|XP_004236611.1| PREDICTED: uncharacterized protein LOC101244... 48 5e-07 >ref|XP_006350189.1| PREDICTED: uncharacterized protein LOC102605422 [Solanum tuberosum] Length = 771 Score = 47.8 bits (112), Expect(3) = 5e-07 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 282 LKMQA*LGFRVVNYLPYNLYIRKMDGYLFA 193 L+MQA LGFRVV+YLPY+ Y+RK GYLFA Sbjct: 167 LEMQAKLGFRVVDYLPYDSYVRKTVGYLFA 196 Score = 25.4 bits (54), Expect(3) = 5e-07 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 397 IHATTDKFTPFANFPSKQ*IVFS 329 I A DK TP+ANF S++ +V S Sbjct: 103 IPAILDKSTPYANFRSEKWVVVS 125 Score = 25.4 bits (54), Expect(3) = 5e-07 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 326 DYPSDSLHKLAGIK 285 DYPSDSL KL IK Sbjct: 128 DYPSDSLRKLGRIK 141 >ref|XP_004236611.1| PREDICTED: uncharacterized protein LOC101244478 [Solanum lycopersicum] Length = 771 Score = 47.8 bits (112), Expect(3) = 5e-07 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 282 LKMQA*LGFRVVNYLPYNLYIRKMDGYLFA 193 L+MQA LGFRVV+YLPY+ Y+RK GYLFA Sbjct: 167 LEMQAKLGFRVVDYLPYDSYVRKTVGYLFA 196 Score = 25.4 bits (54), Expect(3) = 5e-07 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 397 IHATTDKFTPFANFPSKQ*IVFS 329 I A DK TP+ANF S++ +V S Sbjct: 103 IPAILDKSTPYANFRSEKWVVVS 125 Score = 25.4 bits (54), Expect(3) = 5e-07 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 326 DYPSDSLHKLAGIK 285 DYPSDSL KL IK Sbjct: 128 DYPSDSLRKLGRIK 141