BLASTX nr result
ID: Catharanthus22_contig00033149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00033149 (239 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB87099.1| putative retroelement pol polyprotein [Arabidopsi... 58 1e-06 >gb|AAB87099.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1496 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/81 (40%), Positives = 43/81 (53%), Gaps = 6/81 (7%) Frame = -2 Query: 226 DRISGMPIGAGEERDGIYYFRHLPKPSNFACSVQHSDLGALWHKRLGHPSKYVI------ 65 DR IGAGEER+G+YYF + P S + G LWH+RLGHPS V+ Sbjct: 461 DRFLRTLIGAGEEREGVYYFTGVLAPRVHKASSDFAISGDLWHRRLGHPSTSVLLSLPEC 520 Query: 64 NKSLGQTINLDFLDNCTICLR 2 N+S + D +D+C C R Sbjct: 521 NRS---SQGFDKIDSCDTCFR 538