BLASTX nr result
ID: Catharanthus22_contig00033144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00033144 (420 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511938.1| Protein ABIL1, putative [Ricinus communis] g... 64 2e-08 ref|XP_002320167.2| hypothetical protein POPTR_0014s08800g [Popu... 64 3e-08 gb|EMJ19924.1| hypothetical protein PRUPE_ppa009050mg [Prunus pe... 64 3e-08 ref|XP_002279419.1| PREDICTED: protein ABIL1 [Vitis vinifera] 63 4e-08 ref|XP_002880226.1| hypothetical protein ARALYDRAFT_483770 [Arab... 63 5e-08 ref|XP_002301384.2| hypothetical protein POPTR_0002s16750g [Popu... 62 6e-08 gb|EOX95829.1| ABI-1-like 1 isoform 2 [Theobroma cacao] 61 1e-07 gb|EOX95828.1| ABI-1-like 1 isoform 1 [Theobroma cacao] 61 1e-07 emb|CAN69308.1| hypothetical protein VITISV_003083 [Vitis vinifera] 61 1e-07 ref|NP_566067.1| protein ABIL1 [Arabidopsis thaliana] gi|7516048... 60 3e-07 dbj|BAC43461.1| unknown protein [Arabidopsis thaliana] 60 3e-07 ref|XP_006397808.1| hypothetical protein EUTSA_v10001562mg [Eutr... 60 3e-07 ref|XP_006397807.1| hypothetical protein EUTSA_v10001562mg [Eutr... 60 3e-07 ref|NP_001189756.1| protein ABIL1 [Arabidopsis thaliana] gi|3302... 60 3e-07 ref|NP_001118534.1| protein ABIL1 [Arabidopsis thaliana] gi|3302... 60 3e-07 ref|XP_004229960.1| PREDICTED: protein ABIL1-like [Solanum lycop... 59 5e-07 ref|XP_006339648.1| PREDICTED: protein ABIL1-like [Solanum tuber... 59 7e-07 ref|XP_006294665.1| hypothetical protein CARUB_v10023702mg [Caps... 59 9e-07 ref|XP_006294664.1| hypothetical protein CARUB_v10023702mg [Caps... 59 9e-07 ref|XP_004306717.1| PREDICTED: protein ABIL1-like [Fragaria vesc... 58 1e-06 >ref|XP_002511938.1| Protein ABIL1, putative [Ricinus communis] gi|223549118|gb|EEF50607.1| Protein ABIL1, putative [Ricinus communis] Length = 307 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME+E+ E P MTYDEVSMERSK FVKALQELKNLRPQL Sbjct: 1 MEMEQSKPENPHMTYDEVSMERSKSFVKALQELKNLRPQL 40 >ref|XP_002320167.2| hypothetical protein POPTR_0014s08800g [Populus trichocarpa] gi|550323792|gb|EEE98482.2| hypothetical protein POPTR_0014s08800g [Populus trichocarpa] Length = 306 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +3 Query: 297 LMEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 +ME+E+ E P MT+DEVSMERSK F+KALQELKNLRPQL Sbjct: 1 MMELEQTRPENPAMTFDEVSMERSKSFIKALQELKNLRPQL 41 >gb|EMJ19924.1| hypothetical protein PRUPE_ppa009050mg [Prunus persica] Length = 308 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME+E+ G+ P MT+DEVSMERSK FVKALQELKNLRPQL Sbjct: 1 MELEQSGSFNPAMTFDEVSMERSKSFVKALQELKNLRPQL 40 >ref|XP_002279419.1| PREDICTED: protein ABIL1 [Vitis vinifera] Length = 302 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME+++ AE P MT+DEVSMERSK FVKALQELKNLRPQL Sbjct: 1 MELQESRAEHPAMTFDEVSMERSKSFVKALQELKNLRPQL 40 >ref|XP_002880226.1| hypothetical protein ARALYDRAFT_483770 [Arabidopsis lyrata subsp. lyrata] gi|297326065|gb|EFH56485.1| hypothetical protein ARALYDRAFT_483770 [Arabidopsis lyrata subsp. lyrata] Length = 298 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME E G + P MT+DEVSMERSK FVKALQELKNLRPQL Sbjct: 1 METEISGMDNPAMTFDEVSMERSKSFVKALQELKNLRPQL 40 >ref|XP_002301384.2| hypothetical protein POPTR_0002s16750g [Populus trichocarpa] gi|550345172|gb|EEE80657.2| hypothetical protein POPTR_0002s16750g [Populus trichocarpa] Length = 307 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 297 LMEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 +ME+++ E P MT+DEVSMERSK F+KALQELKNLRPQL Sbjct: 1 MMELDQTRPENPAMTFDEVSMERSKSFIKALQELKNLRPQL 41 >gb|EOX95829.1| ABI-1-like 1 isoform 2 [Theobroma cacao] Length = 213 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 MEVE E P MT+DEVSMERSK FVKALQELKNLRPQL Sbjct: 1 MEVEFPRPENPAMTFDEVSMERSKNFVKALQELKNLRPQL 40 >gb|EOX95828.1| ABI-1-like 1 isoform 1 [Theobroma cacao] Length = 299 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 MEVE E P MT+DEVSMERSK FVKALQELKNLRPQL Sbjct: 1 MEVEFPRPENPAMTFDEVSMERSKNFVKALQELKNLRPQL 40 >emb|CAN69308.1| hypothetical protein VITISV_003083 [Vitis vinifera] Length = 302 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME+++ E P MT+DEVSMERSK FVKALQELKNLRPQL Sbjct: 1 MELQESRXEHPAMTFDEVSMERSKSFVKALQELKNLRPQL 40 >ref|NP_566067.1| protein ABIL1 [Arabidopsis thaliana] gi|75160480|sp|Q8S8M5.1|ABIL1_ARATH RecName: Full=Protein ABIL1; AltName: Full=Abl interactor-like protein 1; Short=AtABIL1 gi|20197375|gb|AAM15048.1| expressed protein [Arabidopsis thaliana] gi|21537358|gb|AAM61699.1| unknown [Arabidopsis thaliana] gi|57240092|gb|AAW49256.1| Abl interactor-like protein-1 [Arabidopsis thaliana] gi|108385243|gb|ABF85765.1| At2g46225 [Arabidopsis thaliana] gi|330255565|gb|AEC10659.1| protein ABIL1 [Arabidopsis thaliana] Length = 298 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME E G + P MT DEVSMER+K FVKALQELKNLRPQL Sbjct: 1 METEISGMDNPAMTLDEVSMERNKSFVKALQELKNLRPQL 40 >dbj|BAC43461.1| unknown protein [Arabidopsis thaliana] Length = 298 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME E G + P MT DEVSMER+K FVKALQELKNLRPQL Sbjct: 1 METEISGMDNPAMTLDEVSMERNKSFVKALQELKNLRPQL 40 >ref|XP_006397808.1| hypothetical protein EUTSA_v10001562mg [Eutrema salsugineum] gi|557098881|gb|ESQ39261.1| hypothetical protein EUTSA_v10001562mg [Eutrema salsugineum] Length = 305 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME E A+ P MT+DEVSMERSK FV ALQELKNLRPQL Sbjct: 1 METENSVADNPAMTFDEVSMERSKSFVTALQELKNLRPQL 40 >ref|XP_006397807.1| hypothetical protein EUTSA_v10001562mg [Eutrema salsugineum] gi|557098880|gb|ESQ39260.1| hypothetical protein EUTSA_v10001562mg [Eutrema salsugineum] Length = 293 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME E A+ P MT+DEVSMERSK FV ALQELKNLRPQL Sbjct: 1 METENSVADNPAMTFDEVSMERSKSFVTALQELKNLRPQL 40 >ref|NP_001189756.1| protein ABIL1 [Arabidopsis thaliana] gi|330255567|gb|AEC10661.1| protein ABIL1 [Arabidopsis thaliana] Length = 286 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME E G + P MT DEVSMER+K FVKALQELKNLRPQL Sbjct: 1 METEISGMDNPAMTLDEVSMERNKSFVKALQELKNLRPQL 40 >ref|NP_001118534.1| protein ABIL1 [Arabidopsis thaliana] gi|330255566|gb|AEC10660.1| protein ABIL1 [Arabidopsis thaliana] Length = 329 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME E G + P MT DEVSMER+K FVKALQELKNLRPQL Sbjct: 1 METEISGMDNPAMTLDEVSMERNKSFVKALQELKNLRPQL 40 >ref|XP_004229960.1| PREDICTED: protein ABIL1-like [Solanum lycopersicum] Length = 305 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/41 (75%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +3 Query: 300 MEVEKIG-AEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 MEVE++ P MT+DEVSMERSK FVKALQELKNLRPQL Sbjct: 1 MEVEQLKFGNSPAMTFDEVSMERSKSFVKALQELKNLRPQL 41 >ref|XP_006339648.1| PREDICTED: protein ABIL1-like [Solanum tuberosum] Length = 305 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/42 (78%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = +3 Query: 300 MEVE--KIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 MEVE K+G P MT+DEVSMERSK FVKALQELKNLRPQL Sbjct: 1 MEVEHLKLG-NSPAMTFDEVSMERSKSFVKALQELKNLRPQL 41 >ref|XP_006294665.1| hypothetical protein CARUB_v10023702mg [Capsella rubella] gi|482563373|gb|EOA27563.1| hypothetical protein CARUB_v10023702mg [Capsella rubella] Length = 306 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME E G + MT+DEVSMERSK FVKALQELKNLRPQL Sbjct: 1 METEISGMDHLAMTFDEVSMERSKSFVKALQELKNLRPQL 40 >ref|XP_006294664.1| hypothetical protein CARUB_v10023702mg [Capsella rubella] gi|482563372|gb|EOA27562.1| hypothetical protein CARUB_v10023702mg [Capsella rubella] Length = 294 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME E G + MT+DEVSMERSK FVKALQELKNLRPQL Sbjct: 1 METEISGMDHLAMTFDEVSMERSKSFVKALQELKNLRPQL 40 >ref|XP_004306717.1| PREDICTED: protein ABIL1-like [Fragaria vesca subsp. vesca] Length = 299 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +3 Query: 300 MEVEKIGAEKPPMTYDEVSMERSKCFVKALQELKNLRPQL 419 ME+E+ +P MT+DEVSMERSK FVKALQELKNLRPQL Sbjct: 1 MELEQ---SRPAMTFDEVSMERSKSFVKALQELKNLRPQL 37