BLASTX nr result
ID: Catharanthus22_contig00033065
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00033065 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143230.1| PREDICTED: putative F-box/LRR-repeat protein... 55 1e-05 >ref|XP_004143230.1| PREDICTED: putative F-box/LRR-repeat protein At3g18150-like [Cucumis sativus] gi|449503744|ref|XP_004162155.1| PREDICTED: putative F-box/LRR-repeat protein At3g18150-like [Cucumis sativus] Length = 512 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/69 (43%), Positives = 44/69 (63%), Gaps = 4/69 (5%) Frame = +3 Query: 54 EEKWIEADSKADSSCWNSHEANFF----YHLKNISINGDDIMEPFVLEMVQFLLRSAIVL 221 E KW+EA S W S +F +LK + I G + EP+VLE+++FLL++A+VL Sbjct: 396 EAKWMEAYDFDGKSYWKSQNGDFRGGLRKYLKTVKIYGY-VTEPYVLELIEFLLKNALVL 454 Query: 222 EKMIITYKK 248 EKM+I+ KK Sbjct: 455 EKMVISTKK 463