BLASTX nr result
ID: Catharanthus22_contig00032979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00032979 (587 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516785.1| conserved hypothetical protein [Ricinus comm... 63 5e-08 ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Popu... 61 2e-07 gb|ESW34397.1| hypothetical protein PHAVU_001G149100g [Phaseolus... 60 4e-07 gb|ESW16602.1| hypothetical protein PHAVU_007G169700g [Phaseolus... 57 4e-06 ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659... 57 5e-06 >ref|XP_002516785.1| conserved hypothetical protein [Ricinus communis] gi|223543873|gb|EEF45399.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 63.2 bits (152), Expect = 5e-08 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = +3 Query: 78 RHSFLLRIQRLRSWQRCSRYIQEQRTRVYIIWKCLMILLHWND 206 + S +R + RSWQRCSR ++EQRTR+YIIW+C +ILL W+D Sbjct: 4 QRSAWIRFPKFRSWQRCSRLVKEQRTRLYIIWRCTVILLSWDD 46 >ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] gi|222861166|gb|EEE98708.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] Length = 64 Score = 61.2 bits (147), Expect = 2e-07 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = +3 Query: 93 LRIQRLRSWQRCSRYIQEQRTRVYIIWKCLMILLHWND 206 +R +LRSWQRCS+ I+EQRTR+YIIW+C ++LL W+D Sbjct: 27 MRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64 >gb|ESW34397.1| hypothetical protein PHAVU_001G149100g [Phaseolus vulgaris] Length = 70 Score = 60.1 bits (144), Expect = 4e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = +3 Query: 93 LRIQRLRSWQRCSRYIQEQRTRVYIIWKCLMILLHWND 206 LR +LR W RCS+YI++QRTR+YIIW+C ++LL W+D Sbjct: 33 LRASKLRPWGRCSKYIRQQRTRLYIIWRCTVLLLCWHD 70 >gb|ESW16602.1| hypothetical protein PHAVU_007G169700g [Phaseolus vulgaris] Length = 45 Score = 57.0 bits (136), Expect = 4e-06 Identities = 20/40 (50%), Positives = 34/40 (85%) Frame = +3 Query: 87 FLLRIQRLRSWQRCSRYIQEQRTRVYIIWKCLMILLHWND 206 F +R ++RSW+RCS+ +++QRTR+YIIW+C ++LL W++ Sbjct: 6 FSVRGSKIRSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659834 [Glycine max] Length = 45 Score = 56.6 bits (135), Expect = 5e-06 Identities = 20/40 (50%), Positives = 34/40 (85%) Frame = +3 Query: 87 FLLRIQRLRSWQRCSRYIQEQRTRVYIIWKCLMILLHWND 206 F +R ++RSW+RCS+ +++QRTR+YIIW+C ++LL W++ Sbjct: 6 FSVRGSKVRSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45