BLASTX nr result
ID: Catharanthus22_contig00032904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00032904 (327 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476143.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_006450621.1| hypothetical protein CICLE_v10008407mg [Citr... 55 7e-06 >ref|XP_006476143.1| PREDICTED: pentatricopeptide repeat-containing protein At2g48000-like [Citrus sinensis] Length = 423 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/65 (47%), Positives = 41/65 (63%) Frame = -1 Query: 195 SNTASFQCPNLNSFVSKLLQQPIFSIKAGLDSEEKCSSSIFKSQVFSWDALVIALKSSSP 16 +NT S + N +S+LLQ P+ IK LDS + + F S FSWDAL+ +L+SSSP Sbjct: 30 TNTNSTSVSSSNPLISRLLQVPVSQIKTTLDSVDIFA---FNSSQFSWDALITSLQSSSP 86 Query: 15 KKANL 1 KKA L Sbjct: 87 KKAQL 91 >ref|XP_006450621.1| hypothetical protein CICLE_v10008407mg [Citrus clementina] gi|557553847|gb|ESR63861.1| hypothetical protein CICLE_v10008407mg [Citrus clementina] Length = 423 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/65 (47%), Positives = 41/65 (63%) Frame = -1 Query: 195 SNTASFQCPNLNSFVSKLLQQPIFSIKAGLDSEEKCSSSIFKSQVFSWDALVIALKSSSP 16 +NT S + N +S+LLQ P+ IK LDS + + F S FSWDAL+ +L+SSSP Sbjct: 30 TNTNSTSVSSSNPLISRLLQVPVSHIKTTLDSVDIFA---FNSSQFSWDALITSLQSSSP 86 Query: 15 KKANL 1 KKA L Sbjct: 87 KKAQL 91