BLASTX nr result
ID: Catharanthus22_contig00032815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00032815 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63383.1| hypothetical protein M569_11401 [Genlisea aurea] 45 3e-06 >gb|EPS63383.1| hypothetical protein M569_11401 [Genlisea aurea] Length = 1469 Score = 44.7 bits (104), Expect(2) = 3e-06 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 7/56 (12%) Frame = -3 Query: 148 YGFFVDRTGISGGL------DTTVSLLGYSSSHIDFSICIHNSIP-FHFTDFYGNP 2 +G V TG+SGGL D VSLL + SS+ID + + ++P + FT FYGNP Sbjct: 422 FGVAVSATGLSGGLALFWRKDVCVSLLSFCSSYIDVLVRLTPTLPEWRFTGFYGNP 477 Score = 31.6 bits (70), Expect(2) = 3e-06 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -1 Query: 279 LDSPRAIRALRSFIQSGIPFIVFLVETKCL 190 L S +R LR I S P ++FL ETKCL Sbjct: 379 LRSASTVRRLRDVISSDAPSMIFLSETKCL 408