BLASTX nr result
ID: Catharanthus22_contig00032756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00032756 (416 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73402.1| hypothetical protein M569_01347 [Genlisea aurea] 59 7e-07 >gb|EPS73402.1| hypothetical protein M569_01347 [Genlisea aurea] Length = 350 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 3 HDKLVSVDEQNLFLWSLDTSKKTAQVCRRVTMWNLH 110 HDKLVS+DEQNLFLWSLDTSKKTAQV + +M LH Sbjct: 134 HDKLVSIDEQNLFLWSLDTSKKTAQVQSQESMGMLH 169