BLASTX nr result
ID: Catharanthus22_contig00032668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00032668 (226 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY23974.1| RING/U-box superfamily protein, putative [Theobro... 74 3e-11 ref|XP_002277896.1| PREDICTED: E3 ubiquitin-protein ligase Os04g... 71 2e-10 gb|ESW30285.1| hypothetical protein PHAVU_002G140300g [Phaseolus... 69 5e-10 gb|EMJ10076.1| hypothetical protein PRUPE_ppa026237mg [Prunus pe... 69 5e-10 ref|XP_004136192.1| PREDICTED: E3 ubiquitin-protein ligase Os04g... 69 5e-10 ref|XP_003534279.1| PREDICTED: E3 ubiquitin-protein ligase Os04g... 69 5e-10 ref|XP_003517045.1| PREDICTED: E3 ubiquitin-protein ligase Os04g... 69 5e-10 gb|ACU17851.1| unknown [Glycine max] 69 5e-10 ref|XP_004300406.1| PREDICTED: RING-H2 finger protein ATL51-like... 69 9e-10 ref|XP_003612874.1| RING-H2 finger protein ATL3A [Medicago trunc... 68 1e-09 gb|EXB64911.1| RING-H2 finger protein ATL51 [Morus notabilis] 67 2e-09 gb|ESW28415.1| hypothetical protein PHAVU_003G284600g [Phaseolus... 67 2e-09 ref|XP_003530562.1| PREDICTED: E3 ubiquitin-protein ligase Os04g... 67 3e-09 ref|XP_002303424.2| hypothetical protein POPTR_0003s09190g [Popu... 67 3e-09 ref|XP_003517915.1| PREDICTED: RING-H2 finger protein ATL51-like... 67 3e-09 gb|EMJ19384.1| hypothetical protein PRUPE_ppa007682mg [Prunus pe... 65 7e-09 ref|XP_002527667.1| ring finger protein, putative [Ricinus commu... 65 7e-09 ref|XP_004509804.1| PREDICTED: RING-H2 finger protein ATL51-like... 65 1e-08 ref|XP_002524006.1| ring finger protein, putative [Ricinus commu... 64 2e-08 ref|XP_006428433.1| hypothetical protein CICLE_v10013874mg, part... 63 5e-08 >gb|EOY23974.1| RING/U-box superfamily protein, putative [Theobroma cacao] Length = 370 Score = 73.6 bits (179), Expect = 3e-11 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 MGSI + + WVPYMNTKDCSQGFCSLYCPQWCY+ Sbjct: 1 MGSIGNPRTWVPYMNTKDCSQGFCSLYCPQWCYI 34 >ref|XP_002277896.1| PREDICTED: E3 ubiquitin-protein ligase Os04g0590900-like [Vitis vinifera] Length = 375 Score = 70.9 bits (172), Expect = 2e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 MGS+ S K WVPY++TKDCSQGFCSLYCPQWCY+ Sbjct: 1 MGSLGSPKIWVPYISTKDCSQGFCSLYCPQWCYI 34 >gb|ESW30285.1| hypothetical protein PHAVU_002G140300g [Phaseolus vulgaris] Length = 359 Score = 69.3 bits (168), Expect = 5e-10 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 M S+ + K WVPYMN KDCSQGFCSLYCPQWCY+ Sbjct: 1 MASLGNPKSWVPYMNNKDCSQGFCSLYCPQWCYV 34 >gb|EMJ10076.1| hypothetical protein PRUPE_ppa026237mg [Prunus persica] Length = 342 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = +3 Query: 69 MGSID-SQKPWVPYMNTKDCSQGFCSLYCPQWCY 167 MGS+ S K W+PYMNTKDCSQGFCSLYCPQWCY Sbjct: 1 MGSLGGSPKTWIPYMNTKDCSQGFCSLYCPQWCY 34 >ref|XP_004136192.1| PREDICTED: E3 ubiquitin-protein ligase Os04g0590900-like [Cucumis sativus] gi|449532198|ref|XP_004173069.1| PREDICTED: E3 ubiquitin-protein ligase Os04g0590900-like [Cucumis sativus] Length = 373 Score = 69.3 bits (168), Expect = 5e-10 Identities = 27/54 (50%), Positives = 33/54 (61%) Frame = +3 Query: 63 LNMGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYLXXXXXXXXXXXXXSGPKF 224 + GS + K W+PYM+ KDCSQGFCS+YCPQWCY+ SGP F Sbjct: 1 MGSGSYGNPKTWIPYMSNKDCSQGFCSVYCPQWCYIMFSPPPPLEFPDNSGPHF 54 >ref|XP_003534279.1| PREDICTED: E3 ubiquitin-protein ligase Os04g0590900-like isoform X1 [Glycine max] Length = 370 Score = 69.3 bits (168), Expect = 5e-10 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 M S+ + K WVPYMN KDCSQGFCSLYCPQWCY+ Sbjct: 1 MASLGNPKTWVPYMNNKDCSQGFCSLYCPQWCYV 34 >ref|XP_003517045.1| PREDICTED: E3 ubiquitin-protein ligase Os04g0590900-like [Glycine max] Length = 364 Score = 69.3 bits (168), Expect = 5e-10 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 M S+ + K WVPYMN KDCSQGFCSLYCPQWCY+ Sbjct: 1 MASLGNPKSWVPYMNNKDCSQGFCSLYCPQWCYV 34 >gb|ACU17851.1| unknown [Glycine max] Length = 364 Score = 69.3 bits (168), Expect = 5e-10 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 M S+ + K WVPYMN KDCSQGFCSLYCPQWCY+ Sbjct: 1 MASLGNPKSWVPYMNNKDCSQGFCSLYCPQWCYV 34 >ref|XP_004300406.1| PREDICTED: RING-H2 finger protein ATL51-like [Fragaria vesca subsp. vesca] Length = 367 Score = 68.6 bits (166), Expect = 9e-10 Identities = 26/37 (70%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = +3 Query: 69 MGSIDSQKP---WVPYMNTKDCSQGFCSLYCPQWCYL 170 MGS+ S P W+PYMN++DCSQGFCSLYCPQWCY+ Sbjct: 1 MGSVGSSSPPKTWIPYMNSRDCSQGFCSLYCPQWCYI 37 >ref|XP_003612874.1| RING-H2 finger protein ATL3A [Medicago truncatula] gi|355514209|gb|AES95832.1| RING-H2 finger protein ATL3A [Medicago truncatula] Length = 481 Score = 68.2 bits (165), Expect = 1e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCY 167 M S+ + K WVPYMN+KDCSQGFCS+YCPQWCY Sbjct: 1 MASLGNPKAWVPYMNSKDCSQGFCSVYCPQWCY 33 >gb|EXB64911.1| RING-H2 finger protein ATL51 [Morus notabilis] Length = 379 Score = 67.4 bits (163), Expect = 2e-09 Identities = 26/35 (74%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = +3 Query: 69 MGSIDSQKPWVP-YMNTKDCSQGFCSLYCPQWCYL 170 MGS+ S KPWVP Y N+KDCSQGFCS+YCP+WCY+ Sbjct: 1 MGSLGSPKPWVPTYFNSKDCSQGFCSVYCPKWCYI 35 >gb|ESW28415.1| hypothetical protein PHAVU_003G284600g [Phaseolus vulgaris] Length = 349 Score = 67.4 bits (163), Expect = 2e-09 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 M ++ + + W+PYMN+KDCSQGFCSLYCPQWCY+ Sbjct: 1 MAAVANPRTWIPYMNSKDCSQGFCSLYCPQWCYI 34 >ref|XP_003530562.1| PREDICTED: E3 ubiquitin-protein ligase Os04g0590900-like [Glycine max] Length = 352 Score = 67.0 bits (162), Expect = 3e-09 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 M ++ + + W+PYMN+KDCSQGFCSLYCPQWCY+ Sbjct: 1 MAAVVNPRTWIPYMNSKDCSQGFCSLYCPQWCYI 34 >ref|XP_002303424.2| hypothetical protein POPTR_0003s09190g [Populus trichocarpa] gi|550342795|gb|EEE78403.2| hypothetical protein POPTR_0003s09190g [Populus trichocarpa] Length = 342 Score = 66.6 bits (161), Expect = 3e-09 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 M S+D+ + W+P++N KDCSQGFCSLYCPQWCY+ Sbjct: 1 MASLDAPQTWIPHVNIKDCSQGFCSLYCPQWCYI 34 >ref|XP_003517915.1| PREDICTED: RING-H2 finger protein ATL51-like [Glycine max] Length = 348 Score = 66.6 bits (161), Expect = 3e-09 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 M + + + W+PYMN+KDCSQGFCSLYCPQWCY+ Sbjct: 1 MAVVGNPRTWIPYMNSKDCSQGFCSLYCPQWCYI 34 >gb|EMJ19384.1| hypothetical protein PRUPE_ppa007682mg [Prunus persica] Length = 359 Score = 65.5 bits (158), Expect = 7e-09 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 MGS +Q PW PY N KDCSQG CS+YCPQWCY+ Sbjct: 1 MGSSGNQNPWAPYDNYKDCSQGICSIYCPQWCYI 34 >ref|XP_002527667.1| ring finger protein, putative [Ricinus communis] gi|223532972|gb|EEF34738.1| ring finger protein, putative [Ricinus communis] Length = 383 Score = 65.5 bits (158), Expect = 7e-09 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 M S+ + K W+PY+N KDCS+GFCSLYCPQWCY+ Sbjct: 1 MASLGTPKTWIPYVNGKDCSKGFCSLYCPQWCYI 34 >ref|XP_004509804.1| PREDICTED: RING-H2 finger protein ATL51-like [Cicer arietinum] Length = 345 Score = 65.1 bits (157), Expect = 1e-08 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 M + K W+PY NTKDCSQGFCS+YCPQWCY+ Sbjct: 1 MSPLQYPKTWIPYENTKDCSQGFCSIYCPQWCYI 34 >ref|XP_002524006.1| ring finger protein, putative [Ricinus communis] gi|223536733|gb|EEF38374.1| ring finger protein, putative [Ricinus communis] Length = 323 Score = 63.9 bits (154), Expect = 2e-08 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +3 Query: 69 MGSIDSQKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 MGS+ +Q PW PY KDC+QG CS+YCPQWCY+ Sbjct: 1 MGSVGNQNPWAPYDTYKDCTQGICSIYCPQWCYI 34 >ref|XP_006428433.1| hypothetical protein CICLE_v10013874mg, partial [Citrus clementina] gi|557530490|gb|ESR41673.1| hypothetical protein CICLE_v10013874mg, partial [Citrus clementina] Length = 278 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/35 (68%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = +3 Query: 69 MGSIDS-QKPWVPYMNTKDCSQGFCSLYCPQWCYL 170 MGS+ + WVPY+N+KDCSQGFCSLYCP+WCY+ Sbjct: 1 MGSLGNIPNAWVPYVNSKDCSQGFCSLYCPRWCYI 35