BLASTX nr result
ID: Catharanthus22_contig00032395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00032395 (285 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004243925.1| PREDICTED: uncharacterized protein LOC101262... 60 2e-07 >ref|XP_004243925.1| PREDICTED: uncharacterized protein LOC101262832 [Solanum lycopersicum] Length = 132 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/65 (40%), Positives = 40/65 (61%) Frame = -1 Query: 234 MKPRSDAWNHFIKFINNAGETKPYCNHFQH*YAARSFTNGMSTLNNHMKTCIKNPYNTLS 55 M+PR++ W HF KF + G +K C + YAA + +NG S++N H++TC K P +T+ Sbjct: 40 MEPRANCWKHFEKFTDKNGASKAKCKYCAKAYAASTSSNGTSSMNTHLRTCPKFPRDTVD 99 Query: 54 NGTKL 40 G L Sbjct: 100 KGQDL 104