BLASTX nr result
ID: Catharanthus22_contig00031938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00031938 (489 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63100.1| hypothetical protein VITISV_036853 [Vitis vinifera] 57 3e-06 >emb|CAN63100.1| hypothetical protein VITISV_036853 [Vitis vinifera] Length = 1529 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/63 (38%), Positives = 44/63 (69%) Frame = -2 Query: 416 QEKLAKKLKRKSDRLEKRKDKNNIVCYKCKQIGHYANKCKMKKKINSLDISQELKDSLEK 237 Q ++ K+ ++K + L + K +VC+KC +IGHY C++K+KIN+L++ ++LKD L K Sbjct: 907 QRRMNKEAQKKLEALSQSK----LVCFKCSKIGHYKKDCRVKQKINNLNVVEDLKDXLCK 962 Query: 236 LFI 228 + + Sbjct: 963 VML 965