BLASTX nr result
ID: Catharanthus22_contig00031677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00031677 (261 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510525.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002510525.1| conserved hypothetical protein [Ricinus communis] gi|223551226|gb|EEF52712.1| conserved hypothetical protein [Ricinus communis] Length = 208 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/50 (54%), Positives = 40/50 (80%) Frame = -3 Query: 211 KMEYQKKRYVTFADSPTNFSQVLVPTIDHEEAVLQRHPSLRKSRRKPLIP 62 ++E+QKKRYVTFA+ P+ +QV++P ++ L+RHPSLRK ++KPLIP Sbjct: 146 EIEFQKKRYVTFANPPSQ-AQVMIPGLE----ALERHPSLRKKKKKPLIP 190