BLASTX nr result
ID: Catharanthus22_contig00031573
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00031573 (270 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC63844.1| putative non-LTR retroelement reverse transcripta... 57 3e-06 emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulga... 55 1e-05 >gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1231 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 3/64 (4%) Frame = +1 Query: 88 FFERGL---SRSQCLFNFINFVDSPELVSQF*PITLCNILMKVVTKVIANRLKPILGKLI 258 FFE G+ S + L I V PE + QF P++LCN+L K++TK++ RLK ++ KLI Sbjct: 338 FFETGVLPASTNDALLVLIAKVAKPERIQQFRPVSLCNVLFKIITKMMVTRLKNVISKLI 397 Query: 259 GSTQ 270 G Q Sbjct: 398 GPAQ 401 >emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1378 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = +1 Query: 142 VDSPELVSQF*PITLCNILMKVVTKVIANRLKPILGKLIGSTQ 270 +D P+L F PI LCNI+ K+VTKVI NRLKPIL LI TQ Sbjct: 502 MDIPQLAKHFRPIGLCNIVYKIVTKVIINRLKPILPSLISPTQ 544