BLASTX nr result
ID: Catharanthus22_contig00031493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00031493 (208 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX07771.1| cytochrome P450 [Catharanthus roseus] 85 9e-15 emb|CAA49433.1| cytochrome P-450 [Catharanthus roseus] 55 1e-05 >gb|AEX07771.1| cytochrome P450 [Catharanthus roseus] Length = 506 Score = 85.1 bits (209), Expect = 9e-15 Identities = 42/54 (77%), Positives = 42/54 (77%) Frame = +2 Query: 2 ISFGXXXXXXXXXXXXYHFNWQLPDGSTTLDMTEATGLAARRKYDLQLIATSYA 163 ISFG YHFNWQLPDGSTTLDMTEATGLAARRKYDLQLIATSYA Sbjct: 453 ISFGLANVELPLALLLYHFNWQLPDGSTTLDMTEATGLAARRKYDLQLIATSYA 506 >emb|CAA49433.1| cytochrome P-450 [Catharanthus roseus] Length = 61 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = +2 Query: 50 YHFNWQLPDGST--TLDMTEATGLAARRKYDLQLIATSY 160 YHFNW LPDG T TLDM+E G+ RKYDL LI TSY Sbjct: 21 YHFNWSLPDGLTSETLDMSETWGITTPRKYDLHLIPTSY 59