BLASTX nr result
ID: Catharanthus22_contig00031411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00031411 (563 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003628497.1| NADH dehydrogenase subunit F [Medicago trunc... 108 9e-22 ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago ... 105 6e-21 emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] 61 2e-07 ref|XP_002523276.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 >ref|XP_003628497.1| NADH dehydrogenase subunit F [Medicago truncatula] gi|355522519|gb|AET02973.1| NADH dehydrogenase subunit F [Medicago truncatula] Length = 187 Score = 108 bits (270), Expect = 9e-22 Identities = 54/58 (93%), Positives = 54/58 (93%), Gaps = 1/58 (1%) Frame = -2 Query: 562 TPPVLARSGPWSSVSGLPADKISEIDQPAGLVWLFFSIE-KESAVCASHLLLGSAGRH 392 TPPVL RSGPWSSVSG PADKISEIDQPAGLVWLF SIE KESAVCASHLLLGSAGRH Sbjct: 24 TPPVLIRSGPWSSVSGFPADKISEIDQPAGLVWLFLSIEKKESAVCASHLLLGSAGRH 81 >ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago truncatula] gi|355477332|gb|AES58535.1| hypothetical protein MTR_1g005250 [Medicago truncatula] Length = 197 Score = 105 bits (263), Expect = 6e-21 Identities = 64/111 (57%), Positives = 70/111 (63%), Gaps = 3/111 (2%) Frame = -2 Query: 562 TPPVLARSGPWSSVSGLPADKISEIDQPAGLVWLFFSIE-KESAVCASHLLLGSAGRHGI 386 TPPVL RSGPWSSVSGLPADKISEIDQPAGLVWLF SIE KESAVC Sbjct: 42 TPPVLIRSGPWSSVSGLPADKISEIDQPAGLVWLFLSIEKKESAVC-------------- 87 Query: 385 FVQI*AGRTCDGSQGSNMTT*VYVATILFY--ESGRLFRSSARFFGVVGEG 239 AGRTCDGS SN+ + + ++ E+G L FFGVVGEG Sbjct: 88 -----AGRTCDGSPRSNIYDHLGLRCHDYFSMEAGGLLEVRPGFFGVVGEG 133 >emb|CAN61461.1| hypothetical protein VITISV_029800 [Vitis vinifera] Length = 124 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 562 TPPVLARSGPWSSVSGLPADKISEIDQPAGL 470 TPPVL RSG WSSVSGLPADKISEIDQPAGL Sbjct: 38 TPPVLVRSGLWSSVSGLPADKISEIDQPAGL 68 >ref|XP_002523276.1| conserved hypothetical protein [Ricinus communis] gi|223537489|gb|EEF39115.1| conserved hypothetical protein [Ricinus communis] Length = 136 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +3 Query: 441 SFSIEKNSQTNPAGWSISEILSAGKPETDDHGPDLASTGGV 563 SF E+NSQT P WSIS+ILS GK ETD+ GPDL ST GV Sbjct: 84 SFEAERNSQTKPVVWSISKILSIGKLETDNQGPDLTSTRGV 124