BLASTX nr result
ID: Catharanthus22_contig00031250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00031250 (362 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006386724.1| hypothetical protein POPTR_0002s20040g [Popu... 61 2e-07 ref|XP_002515319.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >ref|XP_006386724.1| hypothetical protein POPTR_0002s20040g [Populus trichocarpa] gi|550345433|gb|ERP64521.1| hypothetical protein POPTR_0002s20040g [Populus trichocarpa] Length = 86 Score = 60.8 bits (146), Expect = 2e-07 Identities = 41/86 (47%), Positives = 53/86 (61%), Gaps = 13/86 (15%) Frame = -3 Query: 309 MASEKCE-EISKERNEVIETTSSSS------------RLGKAVAHRAVYGPNMSRRQGKS 169 MA+EK + E+S N+ I+ TS+ + R GKA+AHRA+YG S R G S Sbjct: 1 MATEKADVEVSDTNNDGIQNTSTHTSVNSETPTSAVPRFGKALAHRALYGS--SSRHGGS 58 Query: 168 RKVRNQLFVDNKTLPSRLSRVSVADD 91 RK R+ D KTLPSRLS+VS+ADD Sbjct: 59 RKARSS---DVKTLPSRLSKVSLADD 81 >ref|XP_002515319.1| conserved hypothetical protein [Ricinus communis] gi|223545799|gb|EEF47303.1| conserved hypothetical protein [Ricinus communis] Length = 83 Score = 55.5 bits (132), Expect = 7e-06 Identities = 35/67 (52%), Positives = 46/67 (68%) Frame = -3 Query: 291 EEISKERNEVIETTSSSSRLGKAVAHRAVYGPNMSRRQGKSRKVRNQLFVDNKTLPSRLS 112 +E S E + + ++ R GKA+AHRA+YG + SRR G SRKVR+ D +TLPSRLS Sbjct: 19 QEKSAESSSNSKEFTAPPRFGKALAHRALYGSS-SRRAG-SRKVRDN---DTRTLPSRLS 73 Query: 111 RVSVADD 91 VS+ADD Sbjct: 74 NVSLADD 80