BLASTX nr result
ID: Catharanthus22_contig00031076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00031076 (211 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY07869.1| TRF-like 8, putative isoform 2 [Theobroma cacao] 65 1e-08 gb|EOY07868.1| TRF-like 8, putative isoform 1 [Theobroma cacao] 65 1e-08 >gb|EOY07869.1| TRF-like 8, putative isoform 2 [Theobroma cacao] Length = 479 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = -3 Query: 182 DESAIPFLEDEAIEFECLLIEPQDRHISVDGFLCFRRNSPEKYVQLEDVHCEF 24 DES +P LEDEA E E LL EP+ H+SVDG LCF + + EK++++ED C F Sbjct: 22 DESIVPGLEDEATEVEHLLAEPKSEHVSVDGVLCFGKENLEKHLKMEDFSCAF 74 >gb|EOY07868.1| TRF-like 8, putative isoform 1 [Theobroma cacao] Length = 478 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = -3 Query: 182 DESAIPFLEDEAIEFECLLIEPQDRHISVDGFLCFRRNSPEKYVQLEDVHCEF 24 DES +P LEDEA E E LL EP+ H+SVDG LCF + + EK++++ED C F Sbjct: 22 DESIVPGLEDEATEVEHLLAEPKSEHVSVDGVLCFGKENLEKHLKMEDFSCAF 74