BLASTX nr result
ID: Catharanthus22_contig00031059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00031059 (307 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298861.1| hypothetical protein POPTR_0001s37520g [Popu... 55 1e-05 >ref|XP_002298861.1| hypothetical protein POPTR_0001s37520g [Populus trichocarpa] gi|118486927|gb|ABK95297.1| unknown [Populus trichocarpa] gi|222846119|gb|EEE83666.1| hypothetical protein POPTR_0001s37520g [Populus trichocarpa] Length = 262 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -3 Query: 251 EEGNEVINMNTEELNQKFEEFIRKMKEEIRIEAAQQQLVVAN 126 ++G E ++T+ELN+KFEEFIRK KEEIR EA QQ LV+AN Sbjct: 221 DDGEENGVLSTQELNEKFEEFIRKTKEEIRTEAQQQYLVMAN 262