BLASTX nr result
ID: Catharanthus22_contig00030794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00030794 (507 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513096.1| conserved hypothetical protein [Ricinus comm... 78 2e-14 ref|XP_002535310.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 gb|EXB63584.1| hypothetical protein L484_026923 [Morus notabilis] 62 6e-08 >ref|XP_002513096.1| conserved hypothetical protein [Ricinus communis] gi|223548107|gb|EEF49599.1| conserved hypothetical protein [Ricinus communis] Length = 813 Score = 77.8 bits (190), Expect(2) = 2e-14 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = +2 Query: 251 HRGVVARVSPPGILHLAFMISTFNCAPETRSKHAHSVGFFHDM 379 H GVVARVS PGILHLAFMISTF CAPETRSKHA V FFHDM Sbjct: 753 HMGVVARVSRPGILHLAFMISTFRCAPETRSKHARPVCFFHDM 795 Score = 26.2 bits (56), Expect(2) = 2e-14 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 216 GRRAPECASDWHIG 257 GRR P CASD H+G Sbjct: 742 GRRGPGCASDRHMG 755 >ref|XP_002535310.1| conserved hypothetical protein [Ricinus communis] gi|255590896|ref|XP_002535392.1| conserved hypothetical protein [Ricinus communis] gi|223523262|gb|EEF26991.1| conserved hypothetical protein [Ricinus communis] gi|223523475|gb|EEF27071.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/58 (62%), Positives = 40/58 (68%) Frame = -2 Query: 494 VCPRFQIEGVGGRCKCPGRTXXXXXXXLEDHWKTPRTRACRERSPLSGRASTVSPGHS 321 +CP + + VGGRC+CPGRT EDH P TRACRERS L GRASTVSPGHS Sbjct: 39 LCPILKKKSVGGRCRCPGRTRLLLTL--EDHRNIPGTRACRERSTLGGRASTVSPGHS 94 >gb|EXB63584.1| hypothetical protein L484_026923 [Morus notabilis] Length = 64 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 290 GYQAEKPGQPLPYVPIASAFRGPAPSSAGEA 198 GYQAEKPGQPLPYVPIASA R PAPSSAGEA Sbjct: 34 GYQAEKPGQPLPYVPIASASRAPAPSSAGEA 64