BLASTX nr result
ID: Catharanthus22_contig00030747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00030747 (528 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361179.1| PREDICTED: germinal-center associated nuclea... 57 3e-06 >ref|XP_006361179.1| PREDICTED: germinal-center associated nuclear protein-like [Solanum tuberosum] Length = 417 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 433 KVRALAICCLNYGGYKPQPFPLADLSKLLVLE 528 +VRALAI C+NYGGYKPQPFPLA LSKLL+++ Sbjct: 329 EVRALAISCVNYGGYKPQPFPLATLSKLLMMK 360