BLASTX nr result
ID: Catharanthus22_contig00030703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00030703 (459 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC13653.1| Probably inactive receptor-like protein kinase [M... 58 1e-06 gb|EMJ20649.1| hypothetical protein PRUPE_ppa021129mg [Prunus pe... 56 6e-06 ref|XP_002515095.1| ATP binding protein, putative [Ricinus commu... 56 6e-06 gb|EOX95546.1| Probably inactive receptor-like protein kinase [T... 55 1e-05 >gb|EXC13653.1| Probably inactive receptor-like protein kinase [Morus notabilis] Length = 645 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 450 SGRGPALEETFSNSSLLQMISMSPDSLYLP 361 S RGPALEETFSNSSLLQMISMSPDS+YLP Sbjct: 616 SKRGPALEETFSNSSLLQMISMSPDSIYLP 645 >gb|EMJ20649.1| hypothetical protein PRUPE_ppa021129mg [Prunus persica] Length = 644 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 450 SGRGPALEETFSNSSLLQMISMSPDSLYLP 361 S RGPALEETFSNSSLLQMISMSPDS Y+P Sbjct: 615 SKRGPALEETFSNSSLLQMISMSPDSTYVP 644 >ref|XP_002515095.1| ATP binding protein, putative [Ricinus communis] gi|223545575|gb|EEF47079.1| ATP binding protein, putative [Ricinus communis] Length = 639 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 453 SSGRGPALEETFSNSSLLQMISMSPDSLYL 364 SS RGPALEETFSNSSLLQMISMSPDS+Y+ Sbjct: 609 SSRRGPALEETFSNSSLLQMISMSPDSIYV 638 >gb|EOX95546.1| Probably inactive receptor-like protein kinase [Theobroma cacao] Length = 639 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 450 SGRGPALEETFSNSSLLQMISMSPDSLYLP 361 S RGPALEETFSNSSLLQMISMSPDS+++P Sbjct: 610 SKRGPALEETFSNSSLLQMISMSPDSIHVP 639