BLASTX nr result
ID: Catharanthus22_contig00030563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00030563 (335 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271143.2| PREDICTED: receptor-like protein kinase HAIK... 57 3e-06 emb|CAN65551.1| hypothetical protein VITISV_033329 [Vitis vinifera] 57 3e-06 gb|EOX97281.1| Leucine-rich receptor-like protein kinase family ... 56 4e-06 ref|XP_006386429.1| leucine-rich repeat transmembrane protein ki... 55 1e-05 ref|XP_003541774.1| PREDICTED: receptor-like protein kinase HAIK... 55 1e-05 >ref|XP_002271143.2| PREDICTED: receptor-like protein kinase HAIKU2 [Vitis vinifera] Length = 975 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +3 Query: 207 DELQTLMQLKSNLQRSNSVVFDTWKLENGACNFTGIVCNSN 329 DELQ L++ KS L++SN+ VFDTW N NFTGIVCNSN Sbjct: 29 DELQILLKFKSALEKSNTSVFDTWTQGNSVRNFTGIVCNSN 69 >emb|CAN65551.1| hypothetical protein VITISV_033329 [Vitis vinifera] Length = 1253 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +3 Query: 207 DELQTLMQLKSNLQRSNSVVFDTWKLENGACNFTGIVCNSN 329 DELQ L++ KS L++SN+ VFDTW N NFTGIVCNSN Sbjct: 29 DELQILLKFKSALEKSNTSVFDTWTQGNSVRNFTGIVCNSN 69 >gb|EOX97281.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7, putative [Theobroma cacao] Length = 984 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = +3 Query: 207 DELQTLMQLKSNLQRSNSVVFDTWKLENGACNFTGIVCNSN 329 DELQ L+ +S L+RSN+ VF +W N CNFTG+VCNSN Sbjct: 30 DELQILLNFRSALERSNTNVFSSWTQGNSPCNFTGVVCNSN 70 >ref|XP_006386429.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|550344721|gb|ERP64226.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 986 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/49 (51%), Positives = 34/49 (69%) Frame = +3 Query: 183 LLWSTF*GDELQTLMQLKSNLQRSNSVVFDTWKLENGACNFTGIVCNSN 329 LL+S DELQ L+ LK++L++SN+ VFD+W C FTGI CNS+ Sbjct: 21 LLFSKIKSDELQILLNLKTSLKKSNTHVFDSWDSNKPICEFTGITCNSD 69 >ref|XP_003541774.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Glycine max] Length = 964 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/63 (46%), Positives = 39/63 (61%) Frame = +3 Query: 138 YNFSLPDMAIFVTQ*LLWSTF*GDELQTLMQLKSNLQRSNSVVFDTWKLENGACNFTGIV 317 + + P +F+ L+ ST DELQ LM+ KS++Q SN+ VF +W N C FTGIV Sbjct: 7 FRYGSPTTLLFLC--LVASTL-SDELQLLMKFKSSIQSSNANVFSSWTQANSPCQFTGIV 63 Query: 318 CNS 326 CNS Sbjct: 64 CNS 66