BLASTX nr result
ID: Catharanthus22_contig00030429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00030429 (285 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT14100.1| Putative LRR receptor-like serine/threonine-prote... 56 6e-06 ref|XP_006385116.1| leucine-rich repeat family protein [Populus ... 55 1e-05 ref|XP_006385112.1| hypothetical protein POPTR_0004s24030g [Popu... 55 1e-05 >gb|EMT14100.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops tauschii] Length = 902 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 104 TKILKQGYWTQGYLDPEYYMTQQLTEKSDVYSFG 3 +K+L + QGYLDPEYYMTQQLTEKSDVYSFG Sbjct: 737 SKLLGEDGRGQGYLDPEYYMTQQLTEKSDVYSFG 770 >ref|XP_006385116.1| leucine-rich repeat family protein [Populus trichocarpa] gi|550341884|gb|ERP62913.1| leucine-rich repeat family protein [Populus trichocarpa] Length = 958 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 104 TKILKQGYWTQGYLDPEYYMTQQLTEKSDVYSFG 3 T + Q T GY+DPEYYMTQQLTEKSDVYSFG Sbjct: 789 THVTTQVKGTMGYMDPEYYMTQQLTEKSDVYSFG 822 >ref|XP_006385112.1| hypothetical protein POPTR_0004s24030g [Populus trichocarpa] gi|550341880|gb|ERP62909.1| hypothetical protein POPTR_0004s24030g [Populus trichocarpa] Length = 959 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 104 TKILKQGYWTQGYLDPEYYMTQQLTEKSDVYSFG 3 T + Q T GY+DPEYYMTQQLTEKSDVYSFG Sbjct: 790 THVTTQVKGTMGYMDPEYYMTQQLTEKSDVYSFG 823