BLASTX nr result
ID: Catharanthus22_contig00030255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00030255 (301 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524557.2| PREDICTED: serine/threonine-protein phosphat... 55 1e-05 ref|XP_006579780.1| PREDICTED: serine/threonine-protein phosphat... 55 1e-05 >ref|XP_003524557.2| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog isoform X1 [Glycine max] gi|571454412|ref|XP_006579781.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog isoform X3 [Glycine max] gi|571454414|ref|XP_006579782.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog isoform X4 [Glycine max] Length = 383 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/58 (44%), Positives = 37/58 (63%) Frame = -2 Query: 261 FTDKSSNVVPSKLWSLVKDVRSFGKFAWGAETLAYLYRNLGAASRVDTKELAGY*SLV 88 F DKS+ L L +D+++ GK+AWGA LAY+Y L AS TK++AGY +L+ Sbjct: 217 FADKSATYADVALLELFRDLKTCGKYAWGASALAYMYDQLNDASMHHTKQMAGYMTLL 274 >ref|XP_006579780.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog isoform X2 [Glycine max] Length = 463 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/58 (44%), Positives = 37/58 (63%) Frame = -2 Query: 261 FTDKSSNVVPSKLWSLVKDVRSFGKFAWGAETLAYLYRNLGAASRVDTKELAGY*SLV 88 F DKS+ L L +D+++ GK+AWGA LAY+Y L AS TK++AGY +L+ Sbjct: 297 FADKSATYADVALLELFRDLKTCGKYAWGASALAYMYDQLNDASMHHTKQMAGYMTLL 354