BLASTX nr result
ID: Catharanthus22_contig00030117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00030117 (583 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006477760.1| PREDICTED: uncharacterized protein LOC102626... 65 1e-08 >ref|XP_006477760.1| PREDICTED: uncharacterized protein LOC102626014 [Citrus sinensis] Length = 67 Score = 65.1 bits (157), Expect = 1e-08 Identities = 37/65 (56%), Positives = 49/65 (75%), Gaps = 2/65 (3%) Frame = +2 Query: 41 MAAGEVVSTKLVRFLYFVSAGFVCTAAINKWRDLEMKANANLIKQQRESGQLLENSN--A 214 MA+G TK++RFLYFV AGF+CTAAINKWR+LE K +L K+Q+ES L ++++ A Sbjct: 6 MASGPA-GTKVLRFLYFVGAGFICTAAINKWRELERK---SLQKKQQESDLLTDDNSATA 61 Query: 215 VQKAV 229 VQK V Sbjct: 62 VQKVV 66